Recombinant Human PPT2 Protein (H00009374-Q01)

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PPT2 Protein Summary

Description
PPT2 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQSSFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETCIEPWLS
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PPT2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PPT2 Protein

  • C6orf8
  • DKFZp564P1516
  • EC 3.1.2
  • EC 3.1.2.-
  • G14
  • lysosomal thioesterase PPT2
  • palmitoyl-protein hydrolase 2
  • palmitoyl-protein thioesterase 2
  • PPT-2
  • S-thioesterase G14
  • VE-statin2

Background

PPT2 - palmitoyl-protein thioesterase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33955
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91687
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57898
Species: Hu
Applications: WB, IHC-P
NBP2-57274
Species: Hu
Applications: WB, ICC/IF
NBP2-57712
Species: Hu
Applications: ICC/IF
NBP1-89810
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89376
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001192-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-32452
Species: Hu, Mu, Rt
Applications: WB
AF6438
Species: Hu, Mu, Rt
Applications: WB, ICC
H00063940-M01
Species: Hu
Applications: WB, ELISA

Publications for PPT2 Partial Recombinant Protein (H00009374-Q01) (0)

There are no publications for PPT2 Partial Recombinant Protein (H00009374-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPT2 Partial Recombinant Protein (H00009374-Q01) (0)

There are no reviews for PPT2 Partial Recombinant Protein (H00009374-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPT2 Partial Recombinant Protein (H00009374-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPT2 Products

Related Products by Gene

Bioinformatics Tool for PPT2 Partial Recombinant Protein (H00009374-Q01)

Discover related pathways, diseases and genes to PPT2 Partial Recombinant Protein (H00009374-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPT2 Partial Recombinant Protein (H00009374-Q01)

Discover more about diseases related to PPT2 Partial Recombinant Protein (H00009374-Q01).
 

Pathways for PPT2 Partial Recombinant Protein (H00009374-Q01)

View related products by pathway.

PTMs for PPT2 Partial Recombinant Protein (H00009374-Q01)

Learn more about PTMs related to PPT2 Partial Recombinant Protein (H00009374-Q01).

Blogs on PPT2

There are no specific blogs for PPT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PPT2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PPT2