POGK Antibody

Images

 
Western Blot: POGK Antibody [NBP1-80336] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

POGK Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human POGK. Peptide sequence MESTAYPLNLSLKEEEEEEEIQSRELEDGPADMQKVRICSEGGWVPALFD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POGK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against POGK and was validated on Western blot.
Control
POGK Lysate (NBP2-65398)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for POGK Antibody

  • BASS2
  • KIAA1513
  • KIAA15131
  • KRAB box domain containing 2
  • KRBOX2
  • LST003
  • pogo transposable element with KRAB domain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-80336
Species: Hu
Applications: WB

Publications for POGK Antibody (NBP1-80336) (0)

There are no publications for POGK Antibody (NBP1-80336).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POGK Antibody (NBP1-80336) (0)

There are no reviews for POGK Antibody (NBP1-80336). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POGK Antibody (NBP1-80336) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for POGK Antibody (NBP1-80336)

Discover related pathways, diseases and genes to POGK Antibody (NBP1-80336). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for POGK Antibody (NBP1-80336)

Find related products by research area.

Blogs on POGK

There are no specific blogs for POGK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POGK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POGK
Uniprot