| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SRTSHREAMSLKGHLQSVTAPMGITMKPAEMIEVDGDANSYIDTLRKYTRPTLQMVICILPNDDKRRYDSI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PIWIL3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in WB reported in reported in scientific literature (PMID: 30701019). In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-31855 | Applications | Species |
|---|---|---|
| Jacobs DI, Qin Q, Fu A et al. piRNA-8041 is downregulated in human glioblastoma and suppresses tumor growth in vitro and in vivo. Oncotarget 2018-12-28 [PMID: 30701019] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.