PIWIL3 Antibody


Immunohistochemistry-Paraffin: PIWIL3 Antibody [NBP2-31855] - Staining of human stomach, upper shows strong membranous positivity in glandular cells.
Simple Western: PIWIL3 Antibody [NBP2-31855] - Simple Western lane view shows a specific band for PIWIL3 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: PIWIL3 Antibody [NBP2-31855] - Electropherogram image(s) of corresponding Simple Western lane view. PIWIL3 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).

Product Details

Reactivity HuSpecies Glossary
Applications Simple Western, IHC, IHC-P

Order Details

PIWIL3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SRTSHREAMSLKGHLQSVTAPMGITMKPAEMIEVDGDANSYIDTLRKYTRPTLQMVICILPNDDKRRYDSI
Specificity of human PIWIL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Simple Western 1:20
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PIWIL3 Protein (NBP2-31855PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PIWIL3 Antibody

  • HIWI3
  • piwi-like 3 (Drosophila)
  • piwi-like protein 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
Species: Hu, Mu
Applications: IHC
Species: Mu
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: Simple Western, IHC, IHC-P

Publications for PIWIL3 Antibody (NBP2-31855) (0)

There are no publications for PIWIL3 Antibody (NBP2-31855).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIWIL3 Antibody (NBP2-31855) (0)

There are no reviews for PIWIL3 Antibody (NBP2-31855). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PIWIL3 Antibody (NBP2-31855) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PIWIL3 Products

Bioinformatics Tool for PIWIL3 Antibody (NBP2-31855)

Discover related pathways, diseases and genes to PIWIL3 Antibody (NBP2-31855). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIWIL3 Antibody (NBP2-31855)

Discover more about diseases related to PIWIL3 Antibody (NBP2-31855).

Pathways for PIWIL3 Antibody (NBP2-31855)

View related products by pathway.

Blogs on PIWIL3

There are no specific blogs for PIWIL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PIWIL3 Antibody and receive a gift card or discount.


Gene Symbol PIWIL3