PI 4 Kinase type 2 beta Antibody


Western Blot: PI 4 Kinase type 2 beta Antibody [NBP1-74233] - Titration: 1.0 ug/ml Positive Control: Mouse Liver.

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

PI 4 Kinase type 2 beta Antibody Summary

Synthetic peptides corresponding to the N terminal of Pi4k2b. Immunizing peptide sequence EDPEFADIVLKAEQAIEIGVFPERISQGSSGSYFVKDSKRNIIGVFKPKS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Pi4k2b and was validated on Western blot.
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
PI 4 Kinase type 2 beta Lysate (NBP2-64889)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PI 4 Kinase type 2 beta Antibody

  • EC
  • FLJ11105
  • phosphatidylinositol 4-kinase type 2 beta
  • phosphatidylinositol 4-kinase type 2-beta
  • Phosphatidylinositol 4-kinase type II-beta
  • phosphatidylinositol 4-kinase type-II beta
  • PIK42B


Together with PI4K2A and the type III PI4Ks (PIK4CA and PIK4CB) Pi4k2b contributes to the overall PI4-kinase activity of the cell. This contribution may be especially significant in plasma membrane, endosomal and Golgi compartments. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Pi4k2b contributes to the production of InsP3 in stimulated cells and is likely to be involved in the regulation of vesicular trafficking.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Species: Mu
Applications: WB

Publications for PI 4 Kinase type 2 beta Antibody (NBP1-74233) (0)

There are no publications for PI 4 Kinase type 2 beta Antibody (NBP1-74233).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PI 4 Kinase type 2 beta Antibody (NBP1-74233) (0)

There are no reviews for PI 4 Kinase type 2 beta Antibody (NBP1-74233). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PI 4 Kinase type 2 beta Antibody (NBP1-74233) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional PI 4 Kinase type 2 beta Products

Bioinformatics Tool for PI 4 Kinase type 2 beta Antibody (NBP1-74233)

Discover related pathways, diseases and genes to PI 4 Kinase type 2 beta Antibody (NBP1-74233). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PI 4 Kinase type 2 beta Antibody (NBP1-74233)

Discover more about diseases related to PI 4 Kinase type 2 beta Antibody (NBP1-74233).

Blogs on PI 4 Kinase type 2 beta

There are no specific blogs for PI 4 Kinase type 2 beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PI 4 Kinase type 2 beta Antibody and receive a gift card or discount.


Gene Symbol PI4K2B