PCMTD2 Antibody


Immunocytochemistry/ Immunofluorescence: PCMTD2 Antibody [NBP2-31698] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: PCMTD2 Antibody [NBP2-31698] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

PCMTD2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: KIIHQETVSKNGNGLKNTPRFKRRRVRRRRMETIVFLDKEVFASRISNPSDDNSCEDL
Specificity of human PCMTD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PCMTD2 Protein (NBP2-31698PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PCMTD2 Antibody

  • C20orf36
  • chromosome 20 open reading frame 36
  • FLJ10883
  • KIAA0835
  • KIAA1050
  • protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 2
  • protein-L-isoaspartate O-methyltransferase domain-containing protein 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for PCMTD2 Antibody (NBP2-31698) (0)

There are no publications for PCMTD2 Antibody (NBP2-31698).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCMTD2 Antibody (NBP2-31698) (0)

There are no reviews for PCMTD2 Antibody (NBP2-31698). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PCMTD2 Antibody (NBP2-31698) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PCMTD2 Products

Bioinformatics Tool for PCMTD2 Antibody (NBP2-31698)

Discover related pathways, diseases and genes to PCMTD2 Antibody (NBP2-31698). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCMTD2 Antibody (NBP2-31698)

Discover more about diseases related to PCMTD2 Antibody (NBP2-31698).

Pathways for PCMTD2 Antibody (NBP2-31698)

View related products by pathway.

Blogs on PCMTD2

There are no specific blogs for PCMTD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PCMTD2 Antibody and receive a gift card or discount.


Gene Symbol PCMTD2