PCARE Antibody

Images

 
Western Blot: PCARE Antibody [NBP2-83369] - WB Suggested Anti-C2orf71 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal kidney

Product Details

Summary
Reactivity Hu, BvSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCARE Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PCARE. Peptide sequence: SPCSPELQGGTRRASPPEFCVLGHGLQPEPRTGHIQDKSQPEAQPQQEEV The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Bovine (90%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
C2orf71
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCARE Antibody

  • Chromosome 2 Open Reading Frame 71
  • Uncharacterized Protein C2orf71

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92038
Species: Hu, Mu
Applications: WB
NBP1-90038
Species: Hu, Ze
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22896
Species: Hu
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P

Publications for PCARE Antibody (NBP2-83369) (0)

There are no publications for PCARE Antibody (NBP2-83369).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCARE Antibody (NBP2-83369) (0)

There are no reviews for PCARE Antibody (NBP2-83369). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCARE Antibody (NBP2-83369) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PCARE Products

Array NBP2-83369

Bioinformatics Tool for PCARE Antibody (NBP2-83369)

Discover related pathways, diseases and genes to PCARE Antibody (NBP2-83369). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCARE Antibody (NBP2-83369)

Discover more about diseases related to PCARE Antibody (NBP2-83369).
 

Pathways for PCARE Antibody (NBP2-83369)

View related products by pathway.

Blogs on PCARE

There are no specific blogs for PCARE, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCARE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C2orf71