Recombinant Human P2Y9 Protein

Images

 
There are currently no images for P2Y9 Recombinant Protein (H00002846-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AP

Order Details

Recombinant Human P2Y9 Protein Summary

Description
An untagged recombinant protein corresponding to the amino acid sequence of (NP_005287.1) for Human P2Y9

Source: Wheat Germ (in vitro) with proprietary liposome technology

Amino Acid Sequence: MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVSLFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLTNIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLATLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF

Preparation
Method
in vitro wheat germ expression system with proprietary liposome technology
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
LPAR4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Immunoaffinity Purification
Theoretical MW
41.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
25 mM Tris-HCl pH8.0 in 2% glycerol.
Preservative
Glycerol
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human P2Y9 Protein

  • G protein-coupled receptor 23
  • GPCR23
  • GPR23
  • GPR23P2Y purinoceptor 9
  • LPA4LPA-4
  • LPAR4
  • lysophosphatidic acid receptor 4
  • P2RY9
  • P2RY9G-protein coupled receptor 23
  • P2Y5-like receptor
  • P2Y5-LIKE
  • P2Y9
  • P2Y9LPA receptor 4
  • Purinergic receptor 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
NBP1-03363
Species: Ch, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NLS426
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF6396
Species: Hu
Applications: WB
NLS850
Species: Hu
Applications: IHC, IHC-P
NBP1-84010
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NLS418
Species: Hu
Applications: IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
NLS2576
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
MAB7089
Species: Mu
Applications: CyTOF-ready, Flow, IHC
NBP2-24712
Species: Ca, Hu, Mu, Pm, Rt, Xp
Applications: IHC, IHC-P, WB
NBP3-03946
Species: Hu, Mu, Rt
Applications: WB
H00002846-G01
Species: Hu
Applications: AP

Publications for P2Y9 Recombinant Protein (H00002846-G01) (0)

There are no publications for P2Y9 Recombinant Protein (H00002846-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P2Y9 Recombinant Protein (H00002846-G01) (0)

There are no reviews for P2Y9 Recombinant Protein (H00002846-G01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for P2Y9 Recombinant Protein (H00002846-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional P2Y9 Products

Bioinformatics Tool for P2Y9 Recombinant Protein (H00002846-G01)

Discover related pathways, diseases and genes to P2Y9 Recombinant Protein (H00002846-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P2Y9 Recombinant Protein (H00002846-G01)

Discover more about diseases related to P2Y9 Recombinant Protein (H00002846-G01).
 

Pathways for P2Y9 Recombinant Protein (H00002846-G01)

View related products by pathway.

PTMs for P2Y9 Recombinant Protein (H00002846-G01)

Learn more about PTMs related to P2Y9 Recombinant Protein (H00002846-G01).

Blogs on P2Y9

There are no specific blogs for P2Y9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human P2Y9 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LPAR4