P2Y1/P2RY1 Antibody [FITC]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: FITC

P2Y1/P2RY1 Antibody [FITC] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 274-373 of human P2Y1/P2RY1 (NP_002554.1).
  
  Sequence:
  IPFHVMKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: P2RY1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for P2Y1/P2RY1 Antibody [FITC]

• ATP receptor
• P2 purinoceptor subtype Y1
• P2RY1
• P2Y purinoceptor 1
• P2Y1
• P2Y1platelet ADP receptor
• purinergic receptor P2Y, G-protein coupled, 1
• Purinergic receptor

Background

P2Y1 is a Purinergic Receptor that causes a change in platelet shape and potentially leads to platelet aggregation by binding ADP, which results in the mobilization of intracellular calcium ions via activation of phospholipase C. This receptor also mediates the release of the relaxing factor nitric oxide and may be involved in the modulation of neuronal signal transmission. P2Y1 has been reported to be expressed in tissues throughout the body, particularly brain. ESTs have been isolated from human embryo, lung, and placenta libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: P2RY1