P2X2/P2RX2 Antibody (3D5) Summary
| Immunogen |
P2RX2 (NP_036358.2, 128 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEKAGESFTELAHKGGVIGVIINWDCDLDLPAS |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
P2RX2 |
| Purity |
Protein A or G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA 1:100-1:2000
- Sandwich ELISA
- Western Blot 1:100-1:2000
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
Protein A or G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for P2X2/P2RX2 Antibody (3D5)
Background
The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. P2X2 has two putative transmembrane domains with intracellular N and C-termini. It can form homomeric channels and heteromeric channels with other members of the family. Six transcript variants encoding six distinct isoforms have been identified for this gene. P2X2 is expressed in brain, spinal cord, sensory and autonomic ganglia as well as in neuroendocrine cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Mu
Applications: IHC, WB
Species: Hu, Pm, Mu, Po, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Publications for P2X2/P2RX2 Antibody (H00022953-M02-100ug) (0)
There are no publications for P2X2/P2RX2 Antibody (H00022953-M02-100ug).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for P2X2/P2RX2 Antibody (H00022953-M02-100ug) (0)
There are no reviews for P2X2/P2RX2 Antibody (H00022953-M02-100ug).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for P2X2/P2RX2 Antibody (H00022953-M02-100ug) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional P2X2/P2RX2 Products
Array H00022953-M02-100ug
Research Areas for P2X2/P2RX2 Antibody (H00022953-M02-100ug)
Find related products by research area.
|
Blogs on P2X2/P2RX2