OGR1 Antibody - BSA Free

Western Blot: OGR1 Antibody [NBP2-93067] - Analysis of extracts from normal (control) and GPR68 knockout (KO) 293T cells, using GPR68 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Product Discontinued

OGR1 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 276-365 of human GPR68 (NP_003476.3). SFNCVADPVLYCFVSETTHRDLARLRGACLAFLTCSRTGRAREAYPLGAPEASGKSGAQGEEPELLTKLHPAFQTPNSPGSGGFPTGRLA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR68
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Knockout Validated
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 41 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for OGR1 Antibody - BSA Free

• G protein-coupled receptor 68
• GPR12A
• GPR68
• G-protein coupled receptor 68
• OGR1
• OGR-1
• ovarian cancer G protein-coupled receptor, 1
• ovarian cancer G-protein coupled receptor 1
• Sphingosylphosphorylcholine receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OGR1 Antibody (NBP2-93067)(3)

Publications using NBP2-93067

• Liu X, Liu Y, Yang RX et al. Loss of myeloid Tsc2 predisposes to angiotensin II-induced aortic aneurysm formation in mice Cell death & disease 2022-11-18 [PMID: 36400753] (Mouse)
• Liu X, Liu Y, Yang RX et al. Loss of myeloid Tsc2 predisposes to angiotensin II-induced aortic aneurysm formation in mice Cell death & disease 2022-11-18 [PMID: 36400753] (Mouse)
• Liu X, Liu Y, Yang RX et al. Loss of myeloid Tsc2 predisposes to angiotensin II-induced aortic aneurysm formation in mice Cell death & disease 2022 Nov 18 [PMID: 36400753] (Mouse )

Bioinformatics

• Gene Symbol: GPR68