MRPS6 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MRPS6 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRPS6.
  
  

  Source: E. coli

  Amino Acid Sequence: SAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MRPS6
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30496.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MRPS6 Recombinant Protein Antigen

• C21orf101
• mitochondrial ribosomal protein S6
• MRP-S6chromosome 21 open reading frame 101
• RPMS628S ribosomal protein S6, mitochondrial
• S6mt

Background

MRPS6, also known as Mitochondrial Ribosomal Protein S6, consists of a 125 amino acid isoform that is 14 kDa, and is a part of the mitochondrial ribosome small subunit 28S, which is involved in protein synthesis. Current disease research is being conducted on the relationship between MRPS6 and myocardial infarction and gigantism. The protein is linked to the process of translation and interacts with KIAA1377, LRIF1, ICT1, SRRM2, and ESR1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MRPS6