MRPS6 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related MRPS6 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-30496PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MRPS6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRPS6.

Source: E. coli

Amino Acid Sequence: SAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MRPS6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30496.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MRPS6 Recombinant Protein Antigen

  • C21orf101
  • mitochondrial ribosomal protein S6
  • MRP-S6chromosome 21 open reading frame 101
  • RPMS628S ribosomal protein S6, mitochondrial
  • S6mt

Background

MRPS6, also known as Mitochondrial Ribosomal Protein S6, consists of a 125 amino acid isoform that is 14 kDa, and is a part of the mitochondrial ribosome small subunit 28S, which is involved in protein synthesis. Current disease research is being conducted on the relationship between MRPS6 and myocardial infarction and gigantism. The protein is linked to the process of translation and interacts with KIAA1377, LRIF1, ICT1, SRRM2, and ESR1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-02399
Species: Bt, Bv, Ca, Ha, Hu, Pm, Rb
Applications: IHC,  IHC-P
AF3918
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86687
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-86595
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-82648
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87964
Species: Hu
Applications: IHC,  IHC-P

Publications for MRPS6 Protein (NBP2-30496PEP) (0)

There are no publications for MRPS6 Protein (NBP2-30496PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS6 Protein (NBP2-30496PEP) (0)

There are no reviews for MRPS6 Protein (NBP2-30496PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MRPS6 Protein (NBP2-30496PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MRPS6 Products

Blogs on MRPS6

There are no specific blogs for MRPS6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MRPS6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS6