MRPS6 Antibody

Immunohistochemistry-Paraffin: MRPS6 Antibody [NBP2-30496] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Product Discontinued

MRPS6 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPS6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MRPS6 Protein (NBP2-30496PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MRPS6 Antibody

• C21orf101
• mitochondrial ribosomal protein S6
• MRP-S6chromosome 21 open reading frame 101
• RPMS628S ribosomal protein S6, mitochondrial
• S6mt

Background

MRPS6, also known as Mitochondrial Ribosomal Protein S6, consists of a 125 amino acid isoform that is 14 kDa, and is a part of the mitochondrial ribosome small subunit 28S, which is involved in protein synthesis. Current disease research is being conducted on the relationship between MRPS6 and myocardial infarction and gigantism. The protein is linked to the process of translation and interacts with KIAA1377, LRIF1, ICT1, SRRM2, and ESR1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPS6
• Uniprot:
  • P82932(Human)