MRPS6 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: SAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MRPS6 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (84%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for MRPS6 Antibody
Background
MRPS6, also known as Mitochondrial Ribosomal Protein S6, consists of a 125 amino acid isoform that is 14 kDa, and is a part of the mitochondrial ribosome small subunit 28S, which is involved in protein synthesis. Current disease research is being conducted on the relationship between MRPS6 and myocardial infarction and gigantism. The protein is linked to the process of translation and interacts with KIAA1377, LRIF1, ICT1, SRRM2, and ESR1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bt, Bv, Ca, Ha, Hu, Pm, Rb
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Publications for MRPS6 Antibody (NBP2-30496) (0)
There are no publications for MRPS6 Antibody (NBP2-30496).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MRPS6 Antibody (NBP2-30496) (0)
There are no reviews for MRPS6 Antibody (NBP2-30496).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for MRPS6 Antibody (NBP2-30496) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MRPS6 Products
Blogs on MRPS6