MRPS33 Antibody

Immunohistochemistry-Paraffin: MRPS33 Antibody [NBP1-84517] - Staining of human placenta shows no positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: MRPS33 Antibody [NBP1-84517] - Staining of human cerebral cortex shows moderate cytoplasmic, nuclear and membranous positivity in neuronal cells.

• Reactivity: Hu
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MRPS33 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPS33
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MRPS33 Protein (NBP1-84517PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MRPS33 Antibody

• CGI-139
• FLJ21123
• mitochondrial ribosomal protein S33,28S ribosomal protein S33, mitochondrial
• MRP-S33
• PTD003
• S33mt

Background

MRPS33, or Mitochondrial Ribosomal Protein S33, consists of a 106 amino acid isoform that is 13 kDa, and is involved in protein synthesis, though its specific function within the process is unknown. There is no current research being conducted on the relationship between MRPS33 and any diseases or disorders. MRPS33 has been linked to the process of translation, and has been found to interact with UBC, C12orf4, MDM2, PIK3C3, and SCHIP1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPS33