MRPS33 Antibody


Immunohistochemistry-Paraffin: MRPS33 Antibody [NBP1-84517] - Staining of human placenta shows no positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: MRPS33 Antibody [NBP1-84517] - Staining of human cerebral cortex shows moderate cytoplasmic, nuclear and membranous positivity in neuronal cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC

Order Details

MRPS33 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MSSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYR
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MRPS33 Protein (NBP1-84517PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (83%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MRPS33 Antibody

  • CGI-139
  • FLJ21123
  • mitochondrial ribosomal protein S33,28S ribosomal protein S33, mitochondrial
  • MRP-S33
  • PTD003
  • S33mt


MRPS33, or Mitochondrial Ribosomal Protein S33, consists of a 106 amino acid isoform that is 13 kDa, and is involved in protein synthesis, though its specific function within the process is unknown. There is no current research being conducted on the relationship between MRPS33 and any diseases or disorders. MRPS33 has been linked to the process of translation, and has been found to interact with UBC, C12orf4, MDM2, PIK3C3, and SCHIP1.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MRPS33 Antibody (NBP1-84517) (0)

There are no publications for MRPS33 Antibody (NBP1-84517).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS33 Antibody (NBP1-84517) (0)

There are no reviews for MRPS33 Antibody (NBP1-84517). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MRPS33 Antibody (NBP1-84517) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MRPS33 Antibody and receive a gift card or discount.


Gene Symbol MRPS33