MRPL18 Antibody - BSA Free

Immunohistochemistry-Paraffin: MRPL18 Antibody [NBP1-83176] - Staining of human colon, kidney, liver and lymph node using Anti-MRPL18 antibody NBP1-83176 (A) shows similar protein distribution across tissues to independent antibody NBP1-83177 (B).

Western Blot: MRPL18 Antibody [NBP1-83176] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: MRPL18 Antibody [NBP1-83176] - Staining of human lymph node.

Immunohistochemistry-Paraffin: MRPL18 Antibody [NBP1-83176] - Staining of human liver.

Immunohistochemistry-Paraffin: MRPL18 Antibody [NBP1-83176] - Staining of human kidney.

Immunohistochemistry-Paraffin: MRPL18 Antibody [NBP1-83176] - Staining of human colon.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPL18 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MRPL18 Antibody - BSA Free (NBP1-83176) is a polyclonal antibody validated for use in IHC and WB. Anti-MRPL18 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MALRSRFWGLFSVCRNPGCRFAALSTSSEPAAKPEVDPVENEAVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRTQHHVEA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPL18
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MRPL18 Protein (NBP1-83176PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MRPL18 Antibody - BSA Free

• HSPC071,39S ribosomal protein L18, mitochondrial
• L18mt
• mitochondrial ribosomal protein L18
• MRP-L18

Background

MRPL18, also known as 39 S ribosomal protein L18, mitochondrial, is a 20.6 kDa, 180 amino acid protein that is involved in importing the cytosolic 5S rRNA in the mitochondria. Currently, no research is being conducted to link this protein to diseases. The protein interacts with other proteins such as AASS, PAX9, AARS2, ABCB7, and ICT1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MRPL18 Antibody (NBP1-83176)(2)

Publications using NBP1-83176

• Zhang X, Gao X, Coots RA et al. Translational control of the cytosolic stress response by mitochondrial ribosomal protein L18. Nat Struct Mol Biol 2015-05-01 [PMID: 25866880]
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: MRPL18