We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human MPPED1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human MPPED1 Protein [H00000758-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Endotoxin, AP

Order Details

Recombinant Human MPPED1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-326 of Human C22orf1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MWRSRWDASVLKAEALALLPCGLGMAFSQSHVMAARRHQHSRLIIEVDEYSSNPTQAFTFYNINQGRFQPPHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLPSEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPRNS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MPPED1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
61.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MPPED1 GST (N-Term) Protein

  • Adult brain protein 239
  • C22orf1MGC88045
  • chromosome 22 open reading frame 1
  • EC 3.1
  • FAM1AFLJ78907
  • FLJ50009
  • FLJ54633,239ABFLJ59965
  • metallophosphoesterase domain containing 1
  • metallophosphoesterase domain-containing protein 1

Background

C22orf1( AAH28035, 1 a.a. - 327 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
AF8150
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
AF2940
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
NB110-60011
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
H00000759-M07
Species: Hu
Applications: ELISA, WB
H00000758-P01
Species: Hu
Applications: WB, ELISA, Endotoxin, AP

Publications for MPPED1 Recombinant Protein (H00000758-P01) (0)

There are no publications for MPPED1 Recombinant Protein (H00000758-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPPED1 Recombinant Protein (H00000758-P01) (0)

There are no reviews for MPPED1 Recombinant Protein (H00000758-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MPPED1 Recombinant Protein (H00000758-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MPPED1 Products

Research Areas for MPPED1 Recombinant Protein (H00000758-P01)

Find related products by research area.

Blogs on MPPED1

There are no specific blogs for MPPED1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MPPED1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MPPED1