![Western Blot: MISP1 Antibody [NBP2-14390] - Analysis in control (vector only transfected HEK293T lysate) and MISP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/MISP1-Antibody-Western-Blot-NBP2-14390-img0009.jpg "Western Blot: MISP1 Antibody [NBP2-14390] - Analysis in control (vector only transfected HEK293T lysate) and MISP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: SQASGITGSYSVSESPFFSPIHLHSNVAWTVEDPVDSAPPGQRKKEQWYAGINPSDGINSEVLEAIRVTRHKNAMAERWESRIYASEEDD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MISP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MISP |
![Immunocytochemistry/Immunofluorescence: MISP1 Antibody [NBP2-14390] - Staining of human cell line U-2 OS shows localization to plasma membrane and focal adhesion sites.](http://images.novusbio.com/fullsize/MISP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14390-img0008.jpg "Immunocytochemistry/Immunofluorescence: MISP1 Antibody [NBP2-14390] - Staining of human cell line U-2 OS shows localization to plasma membrane and focal adhesion sites.")
![Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/MISP1-Antibody-Immunohistochemistry-Paraffin-NBP2-14390-img0015.jpg "Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human stomach, lower shows strong membranous and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/MISP1-Antibody-Immunohistochemistry-Paraffin-NBP2-14390-img0002.jpg "Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human stomach, lower shows strong membranous and cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/MISP1-Antibody-Immunohistochemistry-Paraffin-NBP2-14390-img0005.jpg "Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human small intestine shows high expression.](http://images.novusbio.com/fullsize/MISP1-Antibody-Immunohistochemistry-Paraffin-NBP2-14390-img0006.jpg "Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human small intestine shows high expression.")
![Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining in human small intestine and liver tissues using anti-MISP antibody. Corresponding MISP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MISP1-Antibody-Immunohistochemistry-Paraffin-NBP2-14390-img0007.jpg "Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining in human small intestine and liver tissues using anti-MISP antibody. Corresponding MISP RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human kidney.](http://images.novusbio.com/fullsize/MISP1-Antibody-Immunohistochemistry-Paraffin-NBP2-14390-img0011.jpg "Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Analysis in human small intestine and liver tissues. Corresponding MISP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MISP1-Antibody-Immunohistochemistry-Paraffin-NBP2-14390-img0012.jpg "Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Analysis in human small intestine and liver tissues. Corresponding MISP1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human kidney, liver, small intestine and testis using Anti-MISP1 antibody NBP2-14390 (A) shows similar protein distribution across tissues to independent antibody NBP2-38955 (B).](http://images.novusbio.com/fullsize/MISP1-Antibody-Immunohistochemistry-Paraffin-NBP2-14390-img0013.jpg "Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human kidney, liver, small intestine and testis using Anti-MISP1 antibody NBP2-14390 (A) shows similar protein distribution across tissues to independent antibody NBP2-38955 (B).")
![Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human kidney shows moderate positivity in luminal membrane in cells in tubules.](http://images.novusbio.com/fullsize/MISP1-Antibody-Immunohistochemistry-Paraffin-NBP2-14390-img0014.jpg "Immunohistochemistry-Paraffin: MISP1 Antibody [NBP2-14390] - Staining of human kidney shows moderate positivity in luminal membrane in cells in tubules.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")