![Immunohistochemistry-Paraffin: MINOS1 Antibody [NBP2-31802] - Staining in human thyroid gland and pancreas tissues using anti-MINOS1 antibody. Corresponding MINOS1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MINOS1-Antibody-Immunohistochemistry-Paraffin-NBP2-31802-img0009.jpg "Immunohistochemistry-Paraffin: MINOS1 Antibody [NBP2-31802] - Staining in human thyroid gland and pancreas tissues using anti-MINOS1 antibody. Corresponding MINOS1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit MINOS1 Antibody - BSA Free (NBP2-31802) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQE |
| Predicted Species | Mouse (95%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MINOS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
|
Mitofilin and the Mitochondrial Inner Membrane Organizing System (MINOS) Mitofilin was originally described as a heart muscle protein due to its high expression in the heart. Recently, analysis of the human heart mitochondrial proteome demonstrated that Mitofilin is one of the most abundant mitochondrial proteins (1). Rese... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: MINOS1 Antibody [NBP2-31802] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.](http://images.novusbio.com/fullsize/MINOS1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31802-img0005.jpg "Immunocytochemistry/Immunofluorescence: MINOS1 Antibody [NBP2-31802] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.")
![Immunohistochemistry-Paraffin: MINOS1 Antibody [NBP2-31802] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/MINOS1-Antibody-Immunohistochemistry-Paraffin-NBP2-31802-img0007.jpg "Immunohistochemistry-Paraffin: MINOS1 Antibody [NBP2-31802] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: MINOS1 Antibody [NBP2-31802] - Staining of human thyroid gland shows high expression.](http://images.novusbio.com/fullsize/MINOS1-Antibody-Immunohistochemistry-Paraffin-NBP2-31802-img0008.jpg "Immunohistochemistry-Paraffin: MINOS1 Antibody [NBP2-31802] - Staining of human thyroid gland shows high expression.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")