MINOS1 Antibody


Immunocytochemistry/ Immunofluorescence: MINOS1 Antibody [NBP2-31802] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: MINOS1 Antibody [NBP2-31802] - Staining in human thyroid gland and pancreas tissues using anti-MINOS1 antibody. Corresponding MINOS1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MINOS1 Antibody [NBP2-31802] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Immunohistochemistry-Paraffin: MINOS1 Antibody [NBP2-31802] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: MINOS1 Antibody [NBP2-31802] - Staining of human thyroid gland shows high expression.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

MINOS1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: RMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQE
Specificity of human MINOS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (92%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MINOS1 Protein (NBP2-31802PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MINOS1 Antibody

  • mitochondrial inner membrane organizing system 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ca, Fe
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MINOS1 Antibody (NBP2-31802) (0)

There are no publications for MINOS1 Antibody (NBP2-31802).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MINOS1 Antibody (NBP2-31802) (0)

There are no reviews for MINOS1 Antibody (NBP2-31802). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MINOS1 Antibody (NBP2-31802) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MINOS1 Products

Bioinformatics Tool for MINOS1 Antibody (NBP2-31802)

Discover related pathways, diseases and genes to MINOS1 Antibody (NBP2-31802). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for MINOS1 Antibody (NBP2-31802)

View related products by pathway.

Blogs on MINOS1.

Mitofilin and the Mitochondrial Inner Membrane Organizing System (MINOS)
Mitofilin was originally described as a heart muscle protein due to its high expression in the heart. Recently, analysis of the human heart mitochondrial proteome demonstrated that Mitofilin is one of the most abundant mitochondrial proteins (1). Rese...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MINOS1 Antibody and receive a gift card or discount.


Gene Symbol MINOS1