MAP7D1 Antibody

Images

 
Western Blot: MAP7D1 Antibody [NBP1-70632] - Lanes: Lane 1: 10 ug L929 lysate Lane 2: 10 ug L929+MAP7D1 siRNA Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit HRP Secondary Antibody Dilution: 1:2000 ...read more
Western Blot: MAP7D1 Antibody [NBP1-70632] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAP7D1 Antibody Summary

Immunogen
Synthetic peptides corresponding to MAP7D1(MAP7 domain containing 1) The peptide sequence was selected from the N terminal of MAP7D1. Peptide sequence RRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP7D1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MAP7D1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MAP7D1 Antibody

  • MAP7 domain containing 1

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89951
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40573
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-32075
Species: Hu
Applications: IP
NBP1-70632
Species: Hu, Mu
Applications: WB

Publications for MAP7D1 Antibody (NBP1-70632) (0)

There are no publications for MAP7D1 Antibody (NBP1-70632).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP7D1 Antibody (NBP1-70632) (0)

There are no reviews for MAP7D1 Antibody (NBP1-70632). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAP7D1 Antibody (NBP1-70632) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAP7D1 Products

MAP7D1 NBP1-70632

Bioinformatics Tool for MAP7D1 Antibody (NBP1-70632)

Discover related pathways, diseases and genes to MAP7D1 Antibody (NBP1-70632). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MAP7D1

There are no specific blogs for MAP7D1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAP7D1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP7D1