LYG2 Antibody

Images

 
Western Blot: LYG2 Antibody [NBP1-81278] - Analysis in control (vector only transfected HEK293T lysate) and LYG2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: LYG2 Antibody [NBP1-81278] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells and distinct positivity in extracellular material.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LYG2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GSYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMNCGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPA
Specificity
Specificity of human LYG2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LYG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LYG2 Antibody

  • EC 3.2.1.-
  • LYGHMGC119046
  • lysozyme G-like 2
  • lysozyme g-like protein 2
  • MGC119047
  • MGC119049

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
H00055079-P01
Species: Hu

Publications for LYG2 Antibody (NBP1-81278) (0)

There are no publications for LYG2 Antibody (NBP1-81278).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYG2 Antibody (NBP1-81278) (0)

There are no reviews for LYG2 Antibody (NBP1-81278). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LYG2 Antibody (NBP1-81278) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LYG2 Products

Bioinformatics Tool for LYG2 Antibody (NBP1-81278)

Discover related pathways, diseases and genes to LYG2 Antibody (NBP1-81278). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LYG2

There are no specific blogs for LYG2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LYG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LYG2