LSM5 Antibody

Western Blot: LSM5 Antibody [NBP1-92082] - Analysis in control (vector only transfected HEK293T lysate) and LSM5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: LSM5 Antibody [NBP1-92082] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

Product Discontinued

LSM5 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLV
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LSM5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LSM5 Protein (NBP1-92082PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LSM5 Antibody

• FLJ12710
• LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae)
• U6 snRNA-associated Sm-like protein LSm5
• YER146W

Background

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (seeSNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linkerof variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present intri-snRNP particles, which are important for pre-mRNA splicing.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LSM5