LRRC50 Recombinant Protein Antigen

Images

 
There are currently no images for LRRC50 Recombinant Protein Antigen (NBP2-62685PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LRRC50 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAAF1.

Source: E.coli

Amino Acid Sequence: SLEDQNMCFPKIEVISSLSDDSDPELDYTSLPVLENLPTDTLSNIFAVSKDTSKAARVPFTDIFK

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DNAAF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-62685. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for LRRC50 Recombinant Protein Antigen

  • CILD13
  • DKFZp434A119
  • FLJ25330
  • leucine rich repeat containing 50
  • ODA7leucine-rich repeat-containing protein 50
  • outer row dynein assembly 7 homolog

Background

LRRC50 is a component of the microtubule outer dynein arm and appears to stabilize microtubule-based cilia andactin-based brush order microvilli (van Rooijen et al., 2008 (PubMed 18385425)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84463
Species: Hu
Applications: IHC, IHC-P, IP
NBP1-84466
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-55407
Species: Hu
Applications: ICC/IF
NBP1-84069
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-93878
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-24490
Species: Ca, Eq, Hu, Pm
Applications: IHC, IHC-P, WB
NBP2-02984
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-06363
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-45674
Species: Hu
Applications: IHC, WB
NBP1-76996
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for LRRC50 Recombinant Protein Antigen (NBP2-62685PEP) (0)

There are no publications for LRRC50 Recombinant Protein Antigen (NBP2-62685PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC50 Recombinant Protein Antigen (NBP2-62685PEP) (0)

There are no reviews for LRRC50 Recombinant Protein Antigen (NBP2-62685PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LRRC50 Recombinant Protein Antigen (NBP2-62685PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LRRC50 Products

Bioinformatics Tool for LRRC50 Recombinant Protein Antigen (NBP2-62685PEP)

Discover related pathways, diseases and genes to LRRC50 Recombinant Protein Antigen (NBP2-62685PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRC50 Recombinant Protein Antigen (NBP2-62685PEP)

Discover more about diseases related to LRRC50 Recombinant Protein Antigen (NBP2-62685PEP).
 

Pathways for LRRC50 Recombinant Protein Antigen (NBP2-62685PEP)

View related products by pathway.

Research Areas for LRRC50 Recombinant Protein Antigen (NBP2-62685PEP)

Find related products by research area.

Blogs on LRRC50

There are no specific blogs for LRRC50, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LRRC50 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAAF1