LPAR6/P2RY5 Antibody

Images

 
Immunohistochemistry-Paraffin: LPAR6/P2RY5 Antibody [NBP2-14197] - P2RY5 Antibody [NBP2-14197] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LPAR6/P2RY5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LPAR6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LPAR6/P2RY5 Recombinant Protein Antigen (NBP2-14197PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LPAR6/P2RY5 Antibody

  • ARWH1
  • G-protein coupled purinergic receptor P2Y5
  • LAH3
  • LPA receptor 6
  • LPA-6
  • LPAR6
  • lysophosphatidic acid receptor 6
  • MGC120358
  • Oleoyl-L-alpha-lysophosphatidic acid receptor
  • P2RY5
  • P2RY5ARWH1
  • P2Y purinoceptor 5
  • P2Y5
  • P2Y5RB intron encoded G-protein coupled receptor
  • Purinergic receptor 5
  • purinergic receptor P2Y, G-protein coupled, 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14194
Species: Hu
Applications: IHC, IHC-P
NLS1895
Species: Hu, Mu, Rt, Bt, Ha, Mk, Pm
Applications: Flow, IHC-P
NBL1-12547
Species: Hu
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
AF6589
Species: Hu
Applications: WB
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB110-39032
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NLS877
Species: Hu, Mk, Pm
Applications: IHC, IHC-P, ICC
H00005025-B01P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-17040
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14645
Species: Hu
Applications: IHC, IHC-P
NBP1-32162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-14197
Species: Hu
Applications: IHC, IHC-P

Publications for LPAR6/P2RY5 Antibody (NBP2-14197) (0)

There are no publications for LPAR6/P2RY5 Antibody (NBP2-14197).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LPAR6/P2RY5 Antibody (NBP2-14197) (0)

There are no reviews for LPAR6/P2RY5 Antibody (NBP2-14197). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LPAR6/P2RY5 Antibody (NBP2-14197) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LPAR6/P2RY5 Products

Bioinformatics Tool for LPAR6/P2RY5 Antibody (NBP2-14197)

Discover related pathways, diseases and genes to LPAR6/P2RY5 Antibody (NBP2-14197). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LPAR6/P2RY5 Antibody (NBP2-14197)

Discover more about diseases related to LPAR6/P2RY5 Antibody (NBP2-14197).
 

Pathways for LPAR6/P2RY5 Antibody (NBP2-14197)

View related products by pathway.

Research Areas for LPAR6/P2RY5 Antibody (NBP2-14197)

Find related products by research area.

Blogs on LPAR6/P2RY5

There are no specific blogs for LPAR6/P2RY5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LPAR6/P2RY5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LPAR6
Entrez