LPAR6/P2RY5 Antibody

Immunohistochemistry-Paraffin: LPAR6/P2RY5 Antibody [NBP2-14197] - P2RY5 Antibody [NBP2-14197] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Product Discontinued

LPAR6/P2RY5 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LPAR6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LPAR6/P2RY5 Recombinant Protein Antigen (NBP2-14197PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LPAR6/P2RY5 Antibody

• ARWH1
• G-protein coupled purinergic receptor P2Y5
• LAH3
• LPA receptor 6
• LPA-6
• LPAR6
• lysophosphatidic acid receptor 6
• MGC120358
• Oleoyl-L-alpha-lysophosphatidic acid receptor
• P2RY5
• P2RY5ARWH1
• P2Y purinoceptor 5
• P2Y5
• P2Y5RB intron encoded G-protein coupled receptor
• Purinergic receptor 5
• purinergic receptor P2Y, G-protein coupled, 5

Background

The purinergic receptor P2Y5 (LPAR6/P2RY5) is a member of the Purinergic Receptor subfamily. Membrane-bound P2 receptors mediate the actions of extracellular nucleotides in cell-to-cell signaling. P2Y5 expression has been documented in dendritic cells, monocyte-derived dendritic cells, and macrophages. ESTs have been isolated from embryo, heart/melanocyte/uterus, kidney, liver/spleen, lung, pancreas, placenta, uterus, and vessel libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LPAR6