Recombinant Human LOC399491 GPS, PLAT and transmembrane domain-containing protein Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LOC399491 GPS, PLAT and transmembrane domain-containing protein Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 730 - 829 of Human LOC399491 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HDKINGKKKTAKEHLRKLSMKEREHGEKERQVSEAEENGKLDMKEIHTYMEMFQRAQALRRRAEDYYRCKITPSARKPLCNRCTYNLVLPGSEKKYYSHA

Protein/Peptide Type
Partial Recombinant Protein
Gene
LOC399491

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LOC399491 GPS, PLAT and transmembrane domain-containing protein Protein

  • FLJ13314
  • GPS, PLAT and transmembrane domain-containing protein

Background

LOC399491 - LOC399491 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5699
Species: Hu, Mu
Applications: WB, IHC
NB100-56397
Species: Hu
Applications: WB
NBP1-76602
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB829
Species: Hu
Applications: WB, IHC
NBP1-90136
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP
NB100-93414
Species: Hu
Applications: WB, PEP-ELISA
NBP2-20154
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for LOC399491 GPS, PLAT and transmembrane domain-containing protein Partial Recombinant Protein (H00399491-Q01) (0)

There are no publications for LOC399491 GPS, PLAT and transmembrane domain-containing protein Partial Recombinant Protein (H00399491-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LOC399491 GPS, PLAT and transmembrane domain-containing protein Partial Recombinant Protein (H00399491-Q01) (0)

There are no reviews for LOC399491 GPS, PLAT and transmembrane domain-containing protein Partial Recombinant Protein (H00399491-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LOC399491 GPS, PLAT and transmembrane domain-containing protein Partial Recombinant Protein (H00399491-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LOC399491 GPS, PLAT and transmembrane domain-containing protein Products

LOC399491 GPS, PLAT and transmembrane domain-containing protein H00399491-Q01

Bioinformatics Tool for LOC399491 GPS, PLAT and transmembrane domain-containing protein Partial Recombinant Protein (H00399491-Q01)

Discover related pathways, diseases and genes to LOC399491 GPS, PLAT and transmembrane domain-containing protein Partial Recombinant Protein (H00399491-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LOC399491 GPS, PLAT and transmembrane domain-containing protein Partial Recombinant Protein (H00399491-Q01)

Discover more about diseases related to LOC399491 GPS, PLAT and transmembrane domain-containing protein Partial Recombinant Protein (H00399491-Q01).

Research Areas for LOC399491 GPS, PLAT and transmembrane domain-containing protein Partial Recombinant Protein (H00399491-Q01)

Find related products by research area.

Blogs on LOC399491 GPS, PLAT and transmembrane domain-containing protein

There are no specific blogs for LOC399491 GPS, PLAT and transmembrane domain-containing protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LOC399491 GPS, PLAT and transmembrane domain-containing protein Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LOC399491