LHFPL4 Antibody

Images

 
Western Blot: LHFPL4 Antibody [NBP3-09574] - Western blot analysis of LHFPL4 in Fetal Heart lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LHFPL4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human LHFPL4 (NP_940962). Peptide sequence LCLVLGCMIFPDGWDAETIRDMCGAKTGKYSLGDCSVRWAYILAIIGILN
Clonality
Polyclonal
Host
Rabbit
Gene
LHFPL4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for LHFPL4 Antibody

  • LHFP-like protein 4
  • lipoma HMGIC fusion partner-like 4 protein
  • lipoma HMGIC fusion partner-like 4
  • MGC133162

Background

The LHFPL4 gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans and mice, and a second LHFP-l

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30662
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-43728
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00008715-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-1574
Species: Hu, Mu
Applications: ICC, IHC, IHC-P, IP, KD, WB
NBP2-57678
Species: Hu
Applications: ICC/IF
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P

Publications for LHFPL4 Antibody (NBP3-09574) (0)

There are no publications for LHFPL4 Antibody (NBP3-09574).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LHFPL4 Antibody (NBP3-09574) (0)

There are no reviews for LHFPL4 Antibody (NBP3-09574). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LHFPL4 Antibody (NBP3-09574) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LHFPL4 Products

Array NBP3-09574

Bioinformatics Tool for LHFPL4 Antibody (NBP3-09574)

Discover related pathways, diseases and genes to LHFPL4 Antibody (NBP3-09574). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LHFPL4 Antibody (NBP3-09574)

Discover more about diseases related to LHFPL4 Antibody (NBP3-09574).
 

Pathways for LHFPL4 Antibody (NBP3-09574)

View related products by pathway.

PTMs for LHFPL4 Antibody (NBP3-09574)

Learn more about PTMs related to LHFPL4 Antibody (NBP3-09574).

Blogs on LHFPL4

There are no specific blogs for LHFPL4, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LHFPL4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LHFPL4