L3HYPDH Antibody

Images

 
Western Blot: L3HYPDH Antibody [NBP2-31648] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line U-87 MG
Immunohistochemistry-Paraffin: L3HYPDH Antibody [NBP2-31648] - L3HYPDH at 1:25, using EDTA pre-treatment, on WHO grade I and II meningioma cell lysates on paraffin slides. Relatively weak staining requiring a very high ...read more
Immunohistochemistry-Paraffin: L3HYPDH Antibody [NBP2-31648] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

L3HYPDH Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MESALAVPRLPPHDPGTPVLSVVDMHTGGEPLRIVLAGCPEVSGPTLLAKRRYMRQHLDHVRRRLMFEPRGHRDMYGAVLVPSEL
Specificity
Specificity of human L3HYPDH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
L3HYPDH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Reviewed Applications
Read 1 Review rated 4
using
NBP2-31648 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for L3HYPDH Antibody

  • C14orf149
  • chromosome 14 open reading frame 149
  • EC 5.1.1.4
  • FLJ25436
  • probable proline racemase
  • proline racemase-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for L3HYPDH Antibody (NBP2-31648) (0)

There are no publications for L3HYPDH Antibody (NBP2-31648).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for L3HYPDH Antibody (NBP2-31648) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-31648:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot L3HYPDH NBP2-31648
Enlarge
reviewed by:
Anonymous
WB Human 04/11/2019
View

Summary

ApplicationWestern Blot
Sample TestedIHC-P Sample Tested,whole cell lysate, Sample Amount: 40 ug,Tissue Lysates
SpeciesHuman
LotR77697

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for L3HYPDH Antibody (NBP2-31648) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional L3HYPDH Products

Bioinformatics Tool for L3HYPDH Antibody (NBP2-31648)

Discover related pathways, diseases and genes to L3HYPDH Antibody (NBP2-31648). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on L3HYPDH

There are no specific blogs for L3HYPDH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
04/11/2019
Application: WB
Species: Human

Bioinformatics

Gene Symbol L3HYPDH
Uniprot