KRT222 Antibody


Western Blot: KRT222 Antibody [NBP1-92061] - Analysis in control (vector only transfected HEK293T lysate) and KRT222 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T more
Immunohistochemistry-Paraffin: KRT222 Antibody [NBP1-92061] - Staining of human kidney shows moderate positivity in tubular cells and cells in glomeruli.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

KRT222 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAAQAELKEARRQWHHLQVEIESLHA
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KRT222 Protein (NBP1-92061PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for KRT222 Antibody

  • keratin 222
  • truncated type I keratin KA21


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for KRT222 Antibody (NBP1-92061) (0)

There are no publications for KRT222 Antibody (NBP1-92061).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRT222 Antibody (NBP1-92061) (0)

There are no reviews for KRT222 Antibody (NBP1-92061). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KRT222 Antibody (NBP1-92061) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KRT222 Products

Bioinformatics Tool for KRT222 Antibody (NBP1-92061)

Discover related pathways, diseases and genes to KRT222 Antibody (NBP1-92061). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KRT222

There are no specific blogs for KRT222, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KRT222 Antibody and receive a gift card or discount.


Gene Symbol KRT222