We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ISOC2 Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: ISOC2 Antibody [NBP1-82074] - Staining in human kidney and epididymis tissues using anti-ISOC2 antibody. Corresponding ISOC2 RNA-seq data are presented for ...read more
Western Blot: ISOC2 Antibody [NBP1-82074] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: ISOC2 Antibody [NBP1-82074] - Staining of human cell line HEK 293 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ISOC2 Antibody [NBP1-82074] - Staining of human epididymis shows low expression as expected.
Immunohistochemistry-Paraffin: ISOC2 Antibody [NBP1-82074] - Staining of human kidney shows high expression.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

ISOC2 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GLQVHVVVDACSSRSQVDRLVALARMRQSGAFLSTSEGLILQLVGDAVHPQFKEIQKLIKEPAPDSGLLGLFQGQNSLLH
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ISOC2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ISOC2 Protein (NBP1-82074PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ISOC2 Antibody - BSA Free

  • FLJ18582
  • FLJ23469
  • isochorismatase domain containing 2
  • isochorismatase domain-containing protein 2, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB

Publications for ISOC2 Antibody (NBP1-82074) (0)

There are no publications for ISOC2 Antibody (NBP1-82074).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ISOC2 Antibody (NBP1-82074) (0)

There are no reviews for ISOC2 Antibody (NBP1-82074). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ISOC2 Antibody (NBP1-82074) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ISOC2 Products

Research Areas for ISOC2 Antibody (NBP1-82074)

Find related products by research area.

Blogs on ISOC2

There are no specific blogs for ISOC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ISOC2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ISOC2