IQCH Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: IQCH Antibody [NBP1-82300] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: IQCH Antibody [NBP1-82300] - Staining of human testis shows strong cytoplasmic positivity in granular pattern in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IQCH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PLRALKSLWDYDFLIYDGVIDNTAPDFLAFKEHFSLAWGGIFSLLEHVEKFLRNYAIPEVKIKGNNLVALLPEFELTNKLTRYDLLSVLEDPAHVQMLINLPGQRYKGQD
Specificity
Specificity of human IQCH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IQCH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IQCH Antibody

  • DKFZp434F2114
  • FLJ12476
  • IQ domain-containing protein H
  • IQ motif containing H
  • NYDSP5
  • Testis development protein NYD-SP5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6989
Species: Mu
Applications: IHC
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for IQCH Antibody (NBP1-82300) (0)

There are no publications for IQCH Antibody (NBP1-82300).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IQCH Antibody (NBP1-82300) (0)

There are no reviews for IQCH Antibody (NBP1-82300). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for IQCH Antibody (NBP1-82300) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IQCH Products

Array NBP1-82300

Bioinformatics Tool for IQCH Antibody (NBP1-82300)

Discover related pathways, diseases and genes to IQCH Antibody (NBP1-82300). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for IQCH Antibody (NBP1-82300)

Find related products by research area.

Blogs on IQCH

There are no specific blogs for IQCH, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IQCH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IQCH
Novus 100% Guarantee