IFFO Antibody

Images

 
Immunohistochemistry: IFFO Antibody [NBP2-49598] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IFFO Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTR
Specificity
Specificity of human IFFO antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFFO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IFFO Antibody

  • FLJ20703
  • intermediate filament family orphan 1
  • intermediate filament-like MGC:2625

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
NBP2-49598
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for IFFO Antibody (NBP2-49598) (0)

There are no publications for IFFO Antibody (NBP2-49598).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFFO Antibody (NBP2-49598) (0)

There are no reviews for IFFO Antibody (NBP2-49598). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IFFO Antibody (NBP2-49598) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IFFO Products

Bioinformatics Tool for IFFO Antibody (NBP2-49598)

Discover related pathways, diseases and genes to IFFO Antibody (NBP2-49598). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFFO Antibody (NBP2-49598)

Discover more about diseases related to IFFO Antibody (NBP2-49598).
 

Pathways for IFFO Antibody (NBP2-49598)

View related products by pathway.

PTMs for IFFO Antibody (NBP2-49598)

Learn more about PTMs related to IFFO Antibody (NBP2-49598).

Blogs on IFFO

There are no specific blogs for IFFO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFFO Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFFO1