HSPC280 Antibody

Images

 
Western Blot: HSPC280 Antibody [NBP1-81670] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: HSPC280 Antibody [NBP1-81670] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: HSPC280 Antibody [NBP1-81670] - Staining in human epididymis and skeletal muscle tissues using anti-ABRACL antibody. Corresponding ABRACL RNA-seq data are presented for the same tissues.
Western Blot: HSPC280 Antibody [NBP1-81670] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-275
Immunohistochemistry-Paraffin: HSPC280 Antibody [NBP1-81670] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HSPC280 Antibody [NBP1-81670] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: HSPC280 Antibody [NBP1-81670] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HSPC280 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD
Specificity
Specificity of human, mouse, rat HSPC280 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABRACL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HSPC280 Protein (NBP1-81670PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HSPC280 Antibody

  • ABRA C-terminal like
  • C6orf115
  • chromosome 6 open reading frame 115
  • Costars
  • HSPC280
  • hypothetical protein LOC58527
  • PRO2013
  • RP11-501K14.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-79505
Species: Hu
Applications: WB
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HSPC280 Antibody (NBP1-81670) (0)

There are no publications for HSPC280 Antibody (NBP1-81670).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSPC280 Antibody (NBP1-81670) (0)

There are no reviews for HSPC280 Antibody (NBP1-81670). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HSPC280 Antibody (NBP1-81670) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HSPC280 Antibody (NBP1-81670)

Discover related pathways, diseases and genes to HSPC280 Antibody (NBP1-81670). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on HSPC280

There are no specific blogs for HSPC280, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSPC280 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABRACL