HspBAP1 Antibody

Images

 
Western Blot: HspBAP1 Antibody [NBP1-92014] - Analysis in control (vector only transfected HEK293T lysate) and HSPBAP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: HspBAP1 Antibody [NBP1-92014] - Staining of human cell line SK-MEL-30 shows localization to nucleus & mitochondria.
Immunohistochemistry-Paraffin: HspBAP1 Antibody [NBP1-92014] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: HspBAP1 Antibody [NBP1-92014] - Staining of human cell line U-2 OS shows localization to mitochondria.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HspBAP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LQQPAIFCNMVFDWPARHWNAKYLSQVLHGKQIRFRMGMKSMSTVPQFETTCNYVEATLEEFLTWNCDQSSISGPFRDYDHSKFWAYADYKYFVSLFEDKTDLFQDVKWSDFGFPGRNGQESTLWIGSLGAHTPCHLDSYGCNLVFQ
Specificity
Specificity of human HspBAP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSPBAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • ELISA
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Use in ELISA reported in scientific literature (PMID 29310668).
Control Peptide
Publications
Read Publication using
NBP1-92014 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HspBAP1 Antibody

  • FLJ22623
  • heat shock 27 kDa associated protein
  • HSPB (heat shock 27kD) associated protein 1
  • HSPB (heat shock 27kDa) associated protein 1
  • HSPB1-associated protein 1,27 kDa heat shock protein-associated protein 1
  • PASS1FLJ39386
  • Protein associated with small stress protein 1
  • protein associating with small stress protein PASS1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-75477
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2574
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IHC-Fr (-), KD
H00084925-P01
Species: Hu
NBP1-87466
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
6507-IL/CF
Species: Hu
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP2-68870
Species: Hu
Applications: ICC/IF
NB110-60521
Species: Hu
Applications: WB, Flow

Publications for HspBAP1 Antibody (NBP1-92014)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ELISA.


Filter By Application
ELISA
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for HspBAP1 Antibody (NBP1-92014) (0)

There are no reviews for HspBAP1 Antibody (NBP1-92014). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HspBAP1 Antibody (NBP1-92014) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HspBAP1 Products

Bioinformatics Tool for HspBAP1 Antibody (NBP1-92014)

Discover related pathways, diseases and genes to HspBAP1 Antibody (NBP1-92014). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HspBAP1 Antibody (NBP1-92014)

Discover more about diseases related to HspBAP1 Antibody (NBP1-92014).
 

Pathways for HspBAP1 Antibody (NBP1-92014)

View related products by pathway.

Blogs on HspBAP1

There are no specific blogs for HspBAP1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HspBAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPBAP1
Novus 100% Guarantee