HSD5 Antibody

Images

 
Immunohistochemistry-Paraffin: HSD5 Antibody [NBP2-14471] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: HSD5 Antibody [NBP2-14471] - Staining of human hippocampus shows distinct positivity in astrocytes.
Immunohistochemistry-Paraffin: HSD5 Antibody [NBP2-14471] - Staining of human liver shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: HSD5 Antibody [NBP2-14471] - Staining in human testis and liver tissues using anti-CEP19 antibody. Corresponding CEP19 RNA-seq data are presented for the same ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

HSD5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: MCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CEP19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HSD5 Protein (NBP2-14471PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HSD5 Antibody

  • chromosome 3 open reading frame 34
  • hypothetical protein LOC84984
  • MGC14126

Background

One of the many clones sequenced and characterized coded a 167 amino acids long protein names Chromosome 3 Open reading frame 34 or HSD5. HSD5 is a soluble protein with at least one functional motif based on sequence homology. There exists a phosphoenol pyruvate carboxylase (Ppc) domain starting near the N-terminal domain. The presence of Ppc domain in HSD5 suggest that this gene may be involved in energy production and conversion pathways. Recent data from gene array analyses and differential expression studies suggest that this gene is expressed in various splice variant form and is up-regulated in various cancer cells including prostate and breast cancer cell lines.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HSD5 Antibody (NBP2-14471) (0)

There are no publications for HSD5 Antibody (NBP2-14471).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSD5 Antibody (NBP2-14471) (0)

There are no reviews for HSD5 Antibody (NBP2-14471). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HSD5 Antibody (NBP2-14471) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSD5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CEP19