HSD5 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: MCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CEP19 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (85%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for HSD5 Antibody - BSA Free
Background
One of the many clones sequenced and characterized coded a 167 amino acids long protein names Chromosome 3 Open reading frame 34 or HSD5. HSD5 is a soluble protein with at least one functional motif based on sequence homology. There exists a phosphoenol pyruvate carboxylase (Ppc) domain starting near the N-terminal domain. The presence of Ppc domain in HSD5 suggest that this gene may be involved in energy production and conversion pathways. Recent data from gene array analyses and differential expression studies suggest that this gene is expressed in various splice variant form and is up-regulated in various cancer cells including prostate and breast cancer cell lines.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Publications for HSD5 Antibody (NBP2-14471) (0)
There are no publications for HSD5 Antibody (NBP2-14471).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HSD5 Antibody (NBP2-14471) (0)
There are no reviews for HSD5 Antibody (NBP2-14471).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for HSD5 Antibody (NBP2-14471) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HSD5 Products
Blogs on HSD5