Recombinant Human Histone H3.3B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Histone H3.3B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-136 of Human H3F3B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
H3F3B
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Histone H3.3B Protein

  • H3 histone, family 3A
  • H3 histone, family 3B (H3.3B)
  • H3.3BH3.3A
  • H3F3
  • H3F3A
  • histone H3.3

Background

H3F3B( AAH66901, 1 a.a. - 137 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00007290-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-07996
Species: Hu
NB100-81964
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-07993
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85309
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07995
Species: Hu
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NB21-1023
Species: Hu, Mu, Ce
Applications: WB, ChIP, DB, ICC/IF
NBP2-16840
Species: Hu, Mu, Rt
Applications: WB, DB, EM, ICC/IF, IHC, IHC-Fr, IHC-P
H00008351-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-58095
Species: Hu
Applications: WB
NBP2-07994
Species: Hu
NBL1-11566
Species: Hu
NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Histone H3.3B Recombinant Protein (H00003021-P02) (0)

There are no publications for Histone H3.3B Recombinant Protein (H00003021-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histone H3.3B Recombinant Protein (H00003021-P02) (0)

There are no reviews for Histone H3.3B Recombinant Protein (H00003021-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Histone H3.3B Recombinant Protein (H00003021-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Histone H3.3B Products

Bioinformatics Tool for Histone H3.3B Recombinant Protein (H00003021-P02)

Discover related pathways, diseases and genes to Histone H3.3B Recombinant Protein (H00003021-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Histone H3.3B Recombinant Protein (H00003021-P02)

Discover more about diseases related to Histone H3.3B Recombinant Protein (H00003021-P02).
 

Pathways for Histone H3.3B Recombinant Protein (H00003021-P02)

View related products by pathway.

Research Areas for Histone H3.3B Recombinant Protein (H00003021-P02)

Find related products by research area.

Blogs on Histone H3.3B

There are no specific blogs for Histone H3.3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATRX Antibody
NBP1-83077

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Histone H3.3B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol H3F3B