HHIPL1 Antibody

Immunohistochemistry-Paraffin: HHIPL1 Antibody [NBP2-49058] - Staining of human smooth muscle shows cytoplasmic positivity in smooth muscle cells.

Product Discontinued

HHIPL1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GRLMSLQENPGTGQWQYSEICMGHGQTCEFPGLINNYYPYIISFG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HHIPL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Mouse (84%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HHIPL1 Antibody

• ARAR9245
• HHIP2
• HHIPL1
• HHIP-like 1
• HHIP-like protein 1
• KIAA1822

Background

The HHIPL1 gene encodes a HHIP-like protein 1 that in isoform 1 is 781 amino acids long at 86 kDA and in isoform 2 is 608 amino acids long at 68 kDA. HHIPL1 has been researched regarding its role in gigantism and thyroiditis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HHIPL1