HARBI1 Antibody

Images

 
Western Blot: HARBI1 Antibody [NBP2-55680] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: HARBI1 Antibody [NBP2-55680] - Staining of human cell line PC-3 shows localization to plasma membrane & cytosol.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HARBI1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSV
Specificity
Specificity of human HARBI1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HARBI1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HARBI1 Recombinant Protein Antigen (NBP2-55680PEP)

Reactivity Notes

Mouse 86%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HARBI1 Antibody

  • C11orf77
  • chromosome 11 open reading frame 77
  • EC 3.1
  • FLJ32675
  • harbinger transposase derived 1
  • Harbinger transposase-derived nuclease
  • putative nuclease HARBI1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94593
Species: Hu, Mu, Rt
Applications: WB
NBP1-49620
Species: Hu
Applications: WB, IA, ICC/IF, IHC, IHC-P
NBP2-43666
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-74190
Species: Mu
Applications: WB, ChIP

Publications for HARBI1 Antibody (NBP2-55680) (0)

There are no publications for HARBI1 Antibody (NBP2-55680).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HARBI1 Antibody (NBP2-55680) (0)

There are no reviews for HARBI1 Antibody (NBP2-55680). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HARBI1 Antibody (NBP2-55680) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HARBI1 Products

Bioinformatics Tool for HARBI1 Antibody (NBP2-55680)

Discover related pathways, diseases and genes to HARBI1 Antibody (NBP2-55680). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HARBI1 Antibody (NBP2-55680)

Discover more about diseases related to HARBI1 Antibody (NBP2-55680).
 

Pathways for HARBI1 Antibody (NBP2-55680)

View related products by pathway.

Blogs on HARBI1

There are no specific blogs for HARBI1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HARBI1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HARBI1