GTPBP10 Antibody - BSA Free

Western Blot: GTPBP10 Antibody [NBP1-85055] - Analysis in control (vector only transfected HEK293T lysate) and GTPBP10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: GTPBP10 Antibody [NBP1-85055] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferous ducts.

Western Blot: GTPBP10 Antibody [NBP1-85055] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-257

Immunohistochemistry-Paraffin: GTPBP10 Antibody [NBP1-85055] - Staining of human lymph node shows strong nuclear positivity in a subset of lymphoid cells.

Immunohistochemistry-Paraffin: GTPBP10 Antibody [NBP1-85055] - Staining of human duodenum shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: GTPBP10 Antibody [NBP1-85055] - Staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GTPBP10 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GTPBP10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GTPBP10 Protein (NBP1-85055PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GTPBP10 Antibody - BSA Free

• DKFZP686A10121
• FLJ38242
• GTP-binding protein 10 (putative)
• GTP-binding protein 10
• MGC104191
• ObgH2
• Protein obg homolog 2

Background

Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamentalcellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction (Hiranoet al., 2006 (PubMed 17054726)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GTPBP10 Antibody (NBP1-85055)(4)

Publications using NBP1-85055

• Wang L, Hilander T, Liu X et al. GTPBP8 is required for mitoribosomal biogenesis and mitochondrial translation bioRxiv 2023-05-29 (WB, Human)
  
  Details:
  WB 1:500
• Poerschke S, Oeljeklaus S, Cruz-Zaragoza LD et Al. Identification of TMEM126A as OXA1L-interacting protein reveals cotranslational quality control in mitochondria Mol Cell 2024-01-18 [PMID: 38199007]
• Liang Wang, Taru Hilander, Xiaonan Liu, Hoi Ying Tsang, Ove Eriksson, Christopher B Jackson, Markku Varjosalo, Hongxia Zhao GTPBP8 is required for mitoribosomal biogenesis and mitochondrial translation. Cellular and molecular life sciences : CMLS 2023-11-20 [PMID: 37971521]
• Reyes A, Favia P, Vidoni S et al. RCC1L (WBSCR16) isoforms coordinate mitochondrial ribosome assembly through their interaction with GTPases PLoS Genet. 2020-07-01 [PMID: 32735630] (WB, Human)

Bioinformatics

• Gene Symbol: GTPBP10