GTPBP10 Antibody

Images

 
Western Blot: GTPBP10 Antibody [NBP1-85055] - Analysis in control (vector only transfected HEK293T lysate) and GTPBP10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: GTPBP10 Antibody [NBP1-85055] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferous ducts.
Western Blot: GTPBP10 Antibody [NBP1-85055] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-257
Immunohistochemistry-Paraffin: GTPBP10 Antibody [NBP1-85055] - Staining of human urinary bladder shows strong nuclear positivity in urothelial cells.
Immunohistochemistry-Paraffin: GTPBP10 Antibody [NBP1-85055] - Staining of human lymph node shows strong nuclear positivity in a subset of lymphoid cells.
Immunohistochemistry-Paraffin: GTPBP10 Antibody [NBP1-85055] - Staining of human duodenum shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: GTPBP10 Antibody [NBP1-85055] - Staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GTPBP10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAF
Specificity
Specificity of human GTPBP10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GTPBP10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GTPBP10 Protein (NBP1-85055PEP)
Publications
Read Publication using
NBP1-85055 in the following applications:

  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GTPBP10 Antibody

  • DKFZP686A10121
  • FLJ38242
  • GTP-binding protein 10 (putative)
  • GTP-binding protein 10
  • MGC104191
  • ObgH2
  • Protein obg homolog 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91975
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85055
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GTPBP10 Antibody (NBP1-85055)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for GTPBP10 Antibody (NBP1-85055) (0)

There are no reviews for GTPBP10 Antibody (NBP1-85055). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GTPBP10 Antibody (NBP1-85055) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GTPBP10 Products

Bioinformatics Tool for GTPBP10 Antibody (NBP1-85055)

Discover related pathways, diseases and genes to GTPBP10 Antibody (NBP1-85055). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GTPBP10

There are no specific blogs for GTPBP10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTPBP10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GTPBP10