Reactivity | HuSpecies Glossary |
Applications | WB, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | BSA Free |
Description | Novus Biologicals Rabbit GTPBP10 Antibody - BSA Free (NBP1-85055) is a polyclonal antibody validated for use in IHC and WB. Anti-GTPBP10 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAF |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | GTPBP10 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publications using NBP1-85055 | Applications | Species |
---|---|---|
Wang L, Hilander T, Liu X et al. GTPBP8 is required for mitoribosomal biogenesis and mitochondrial translation bioRxiv 2023-05-29 (WB, Human) Details: WB 1:500 |
WB | Human |
Poerschke S, Oeljeklaus S, Cruz-Zaragoza LD et Al. Identification of TMEM126A as OXA1L-interacting protein reveals cotranslational quality control in mitochondria Mol Cell 2024-01-18 [PMID: 38199007] | ||
Liang Wang, Taru Hilander, Xiaonan Liu, Hoi Ying Tsang, Ove Eriksson, Christopher B Jackson, Markku Varjosalo, Hongxia Zhao GTPBP8 is required for mitoribosomal biogenesis and mitochondrial translation. Cellular and molecular life sciences : CMLS 2023-11-20 [PMID: 37971521] | ||
Reyes A, Favia P, Vidoni S et al. RCC1L (WBSCR16) isoforms coordinate mitochondrial ribosome assembly through their interaction with GTPases PLoS Genet. 2020-07-01 [PMID: 32735630] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | GTPBP10 |