Recombinant Human GSG1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human GSG1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-282 of Human GSG1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MELSKAFSGQRTLLSAILSMLSLSFSTTSLLSNYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGDDRFSFRSFRSGMWLSCEETVEEPGERCRSFIELTPPAKRGEKGLLEFATLQGPCHPTLRFGGKRLMEKASLPSPPLGLCGKNPMVIPGNADHLHRTSIHQLPPATNRLATHWEPCLWAQTERLCCCFLCPVRSPGDGGPHDVFTSLPSDCQLGSRRLETTCLELWLGLLHGLALLHLLHGVGCHHLQHVHQDGAGVQVQA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
GSG1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
57.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GSG1 Protein

  • germ cell associated 1
  • germ cell-specific gene 1 protein
  • MGC111023
  • MGC3146

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00056903-P01
Species: Hu
NBP2-45955
Species: Hu
Applications: WB
H00006218-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-342
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-24530
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P, Flow-IC
NBP2-45492
Species: Hu
Applications: WB, IHC
NBP1-88883
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7288
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-55202
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GSG1 Recombinant Protein (H00083445-P01) (0)

There are no publications for GSG1 Recombinant Protein (H00083445-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GSG1 Recombinant Protein (H00083445-P01) (0)

There are no reviews for GSG1 Recombinant Protein (H00083445-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GSG1 Recombinant Protein (H00083445-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GSG1 Products

Bioinformatics Tool for GSG1 Recombinant Protein (H00083445-P01)

Discover related pathways, diseases and genes to GSG1 Recombinant Protein (H00083445-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSG1 Recombinant Protein (H00083445-P01)

Discover more about diseases related to GSG1 Recombinant Protein (H00083445-P01).
 

Pathways for GSG1 Recombinant Protein (H00083445-P01)

View related products by pathway.

Blogs on GSG1

There are no specific blogs for GSG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GSG1 Antibody
NBP1-56435
Carm1 Antibody
NB200-342

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GSG1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GSG1