GRPEL1 Antibody

Images

 
Orthogonal Strategies: Western Blot: GRPEL1 Antibody [NBP1-83557] - Analysis in human cell lines PC-3 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunocytochemistry/ Immunofluorescence: GRPEL1 Antibody [NBP1-83557] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GRPEL1 Antibody [NBP1-83557] - Staining of human duodenum shows strong cytoplasmic positivity, with a granular pattern in glandular cells.
Western Blot: GRPEL1 Antibody [NBP1-83557] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: GRPEL1 Antibody [NBP1-83557] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

GRPEL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRPEL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
ICC/IF reported in scientific literature (PMID: 30098457). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GRPEL1 Protein (NBP1-83557PEP)
Publications
Read Publication using
NBP1-83557 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GRPEL1 Antibody

  • FLJ25609
  • GREPEL1
  • grpE protein homolog 1, mitochondrial
  • GrpE-like 1, mitochondrial (E. coli)
  • GrpE-like protein cochaperone
  • HMGEmt-GrpE#1
  • Mt-GrpE#1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-03433
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-80461
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-37912
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85099
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-15508
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-02996
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-70951
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
H00010049-M01
Species: Hu
Applications: ELISA, ICC/IF (-), IHC, WB
NBP2-67427
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF1543
Species: Hu
Applications: IHC, WB
NB100-2322
Species: Bv, Ca, Hu, Mu, Rb, Rt, Sh
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB100-56082
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-71648
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, KO, Simple Western, WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

Publications for GRPEL1 Antibody (NBP1-83557)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for GRPEL1 Antibody (NBP1-83557) (0)

There are no reviews for GRPEL1 Antibody (NBP1-83557). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GRPEL1 Antibody (NBP1-83557) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRPEL1 Products

Bioinformatics Tool for GRPEL1 Antibody (NBP1-83557)

Discover related pathways, diseases and genes to GRPEL1 Antibody (NBP1-83557). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRPEL1 Antibody (NBP1-83557)

Discover more about diseases related to GRPEL1 Antibody (NBP1-83557).
 

Pathways for GRPEL1 Antibody (NBP1-83557)

View related products by pathway.

Research Areas for GRPEL1 Antibody (NBP1-83557)

Find related products by research area.

Blogs on GRPEL1

There are no specific blogs for GRPEL1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRPEL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRPEL1