GRPEL1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GRPEL1 Antibody [NBP1-83557] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.

Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in human cell lines PC-3 and HeLa using Anti-GRPEL1 antibody. Corresponding GRPEL1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GRPEL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GRPEL1 Antibody - BSA Free (NBP1-83557) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-GRPEL1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRPEL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GRPEL1 Protein (NBP1-83557PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GRPEL1 Antibody - BSA Free

• FLJ25609
• GREPEL1
• grpE protein homolog 1, mitochondrial
• GrpE-like 1, mitochondrial (E. coli)
• GrpE-like protein cochaperone
• HMGEmt-GrpE#1
• Mt-GrpE#1

Background

Essential component of the PAM complex, a complex required for the translocation of transitpeptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems tocontrol the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GRPEL1 Antibody (NBP1-83557)(1)

Publication using NBP1-83557

• Konovalova S, Liu X, Manjunath P et al. Redox regulation of GRPEL2 nucleotide exchange factor for mitochondrial HSP70 chaperone Redox Biol 2018-08-04 [PMID: 30098457] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: GRPEL1