GRPEL1 Antibody

Images

 
Western Blot: GRPEL1 Antibody [NBP1-83557] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: GRPEL1 Antibody [NBP1-83557] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemistry-Paraffin: GRPEL1 Antibody [NBP1-83557] - Staining of human duodenum shows strong cytoplasmic positivity, with a granular pattern in glandular cells.
Western Blot: GRPEL1 Antibody [NBP1-83557] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRPEL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRPEL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GRPEL1 Protein (NBP1-83557PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GRPEL1 Antibody

  • FLJ25609
  • GREPEL1
  • grpE protein homolog 1, mitochondrial
  • GrpE-like 1, mitochondrial (E. coli)
  • GrpE-like protein cochaperone
  • HMGEmt-GrpE#1
  • Mt-GrpE#1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37912
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85099
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86859
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF1543
Species: Hu
Applications: WB, IHC
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-56082
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-71648
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for GRPEL1 Antibody (NBP1-83557) (0)

There are no publications for GRPEL1 Antibody (NBP1-83557).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRPEL1 Antibody (NBP1-83557) (0)

There are no reviews for GRPEL1 Antibody (NBP1-83557). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GRPEL1 Antibody (NBP1-83557) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRPEL1 Products

Bioinformatics Tool for GRPEL1 Antibody (NBP1-83557)

Discover related pathways, diseases and genes to GRPEL1 Antibody (NBP1-83557). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRPEL1 Antibody (NBP1-83557)

Discover more about diseases related to GRPEL1 Antibody (NBP1-83557).
 

Pathways for GRPEL1 Antibody (NBP1-83557)

View related products by pathway.

Blogs on GRPEL1

There are no specific blogs for GRPEL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRPEL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRPEL1