Recombinant Human GPR34 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human GPR34 Protein [H00002857-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human GPR34 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-381 of Human GPR34 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTSYSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKWTLGVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWMLALGGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCYWKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLHDTSVAVKIQSSSKST

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
GPR34
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
70.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GPR34 GST (N-Term) Protein

  • G protein-coupled receptor 34
  • GPR34
  • probable G-protein coupled receptor 34

Background

G protein-coupled receptors (GPCRs), such as GPR34, are integral membrane proteins containing 7 putative transmembrane domains (TMs). These proteins mediate signals to the interior of the cell via activation of heterotrimeric G proteins that in turn activate various effector proteins, ultimately resulting in a physiologic response.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NLS418
Species: Hu
Applications: IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
NLS2576
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
AF2377
Species: Mu
Applications: IHC, Simple Western, WB
NLS542
Species: Hu
Applications: IHC, IHC-P
NBP1-57508
Species: Hu
Applications: IHC, IHC-P, WB
NB100-58974
Species: Bv, Hu, Pm, Pm, Rb
Applications: IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NLS850
Species: Hu
Applications: IHC, IHC-P

Publications for GPR34 Recombinant Protein (H00002857-P01) (0)

There are no publications for GPR34 Recombinant Protein (H00002857-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR34 Recombinant Protein (H00002857-P01) (0)

There are no reviews for GPR34 Recombinant Protein (H00002857-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR34 Recombinant Protein (H00002857-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GPR34 Products

Array H00002857-P01

Bioinformatics Tool for GPR34 Recombinant Protein (H00002857-P01)

Discover related pathways, diseases and genes to GPR34 Recombinant Protein (H00002857-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR34 Recombinant Protein (H00002857-P01)

Discover more about diseases related to GPR34 Recombinant Protein (H00002857-P01).
 

Pathways for GPR34 Recombinant Protein (H00002857-P01)

View related products by pathway.

PTMs for GPR34 Recombinant Protein (H00002857-P01)

Learn more about PTMs related to GPR34 Recombinant Protein (H00002857-P01).
 

Research Areas for GPR34 Recombinant Protein (H00002857-P01)

Find related products by research area.

Blogs on GPR34.

Antibody treatment can generate microglia-like cells from bone marrow
By Jennifer Sokolowski, MD, PhD.Microglia play important roles in the brain in both homeostatic and pathological conditions, acting to clear debris and dying cells. There is evidence to suggest that microglial dys...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GPR34 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR34