We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GPR34 Recombinant Protein Antigen

Images

 
There are currently no images for GPR34 Protein (NBP1-87583PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GPR34 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPR34.

Source: E. coli

Amino Acid Sequence: RSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GPR34
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87583.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GPR34 Recombinant Protein Antigen

  • G protein-coupled receptor 34
  • GPR34
  • probable G-protein coupled receptor 34

Background

GPR34 is an Orphan-A GPCR with an unknown ligand. It is similar to the P2Y receptor subfamily. GPR34 has been reported to be expressed in the brain, particularly in caudate, frontal cortex, putamen, and thalamus, as well as in eye, liver, and testis. ESTs have been isolated from adipose, B-cell/lung/testis, eye, liver/spleen, placenta, tonsil, and uterus libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NLS418
Species: Hu
Applications: IHC,  IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC,  IHC-P
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC,  IHC-P
NLS2576
Species: Hu, Pm, Rt
Applications: IHC,  IHC-P
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-55877
Species: Hu
Applications: IHC,  IHC-P
AF2377
Species: Mu
Applications: IHC, Simple Western, WB
NLS542
Species: Hu
Applications: IHC,  IHC-P
NBP1-57508
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-30949
Species: Hu
Applications: IHC,  IHC-P
NLS850
Species: Hu
Applications: IHC,  IHC-P
NBP1-87583PEP
Species: Hu
Applications: AC

Publications for GPR34 Protein (NBP1-87583PEP) (0)

There are no publications for GPR34 Protein (NBP1-87583PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR34 Protein (NBP1-87583PEP) (0)

There are no reviews for GPR34 Protein (NBP1-87583PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GPR34 Protein (NBP1-87583PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GPR34 Products

Array NBP1-87583PEP

Research Areas for GPR34 Protein (NBP1-87583PEP)

Find related products by research area.

Blogs on GPR34.

Antibody treatment can generate microglia-like cells from bone marrow
By Jennifer Sokolowski, MD, PhD.Microglia play important roles in the brain in both homeostatic and pathological conditions, acting to clear debris and dying cells. There is evidence to suggest that microglial dys...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GPR34 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR34