GPR154 Antibody (2F5) - Azide and BSA Free

Western Blot: GPR154 Antibody (2F5) [H00387129-M01] - Detection against Immunogen (31.46 KDa) .

ELISA: GPR154 Antibody (2F5) [H00387129-M01] - Detection limit for recombinant GST tagged GPR154 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2F5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GPR154 Antibody (2F5) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse GPR154 Antibody (2F5) - Azide and BSA Free (H00387129-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: GPR154 (NP_997056, 2 a.a. ~ 53 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQL
• Specificity: GPR154 - G protein-coupled receptor 154
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NPSR1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GPR154 Antibody (2F5) - Azide and BSA Free

• G protein-coupled receptor 154
• G protein-coupled receptor for asthma susceptibility
• GPR154NPSR
• GPRAASRT2
• G-protein coupled receptor 154
• G-protein coupled receptor for asthma susceptibility
• G-protein coupled receptor PGR14
• neuropeptide S receptor 1
• neuropeptide S receptor
• PGR14VRR1
• vasopressin receptor-related receptor 1

Background

This gene is a member of the G protein-coupled receptor 1 family and encodes a plasma membrane protein. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Mutations in this gene have also been associated with this disease. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NPSR1
• Entrez:
  • 387129(Human)
• OMIM:
  • 608584(Human)
• Uniprot:
  • NP_997056(Human)