GPR133 Antibody - Azide and BSA Free

Western Blot: GPR133 Antibody [NBP3-03815] - Analysis of extracts of various cell lines, using GPR133 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.

Product Discontinued

GPR133 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 805-874 of human GPR133 (NP_942122.2). FHCLLNSEVRAAFKHKTKVWSLTSSSARTSNAKPFHSDLMNGTRPGMASTKLSPWDKSSHSAHRVDLSAV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADGRD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for GPR133 Antibody - Azide and BSA Free

• DKFZp434B1272
• FLJ16770
• G protein-coupled receptor 133
• GPR133
• G-protein coupled receptor PGR25
• MGC138514
• PGR25
• PGR25MGC138512
• probable G-protein coupled receptor 133

Background

GPR133 is an Orphan-U GPCR with an unknown ligand. ESTs have been isolated from brain, liver/spleen, lung, and testis libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ADGRD1