GPR133 Antibody

Immunohistochemistry-Paraffin: GPR133 Antibody [NBP1-85142] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells with distinct extracellular material.

Product Discontinued

GPR133 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NSEVRAAFKHKTKVWSLTSSSARTSNAKPFHSDLMNGTRPGMASTKLSPWDKSSHSAHRVDLSAV
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADGRD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Rat (86%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GPR133 Antibody

• DKFZp434B1272
• FLJ16770
• G protein-coupled receptor 133
• GPR133
• G-protein coupled receptor PGR25
• MGC138514
• PGR25
• PGR25MGC138512
• probable G-protein coupled receptor 133

Background

GPR133 is an Orphan-U GPCR with an unknown ligand. ESTs have been isolated from brain, liver/spleen, lung, and testis libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADGRD1