GPR108 Antibody

Images

 
Western Blot: GPR108 Antibody [NBP2-56970] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: GPR108 Antibody [NBP2-56970] - Staining of human cell line SiHa shows localization to the Golgi apparatus. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR108 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QPTGNNPYLQLPQEDEEDVQMEQVMTDSGFREGLSKVNKTASGRELL
Specificity
Specificity of human GPR108 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPR108
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GPR108 Recombinant Protein Antigen (NBP2-56970PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GPR108 Antibody

  • G protein-coupled receptor 108
  • GPR108
  • LUSTR2
  • LUSTR2Lung seven transmembrane receptor 2
  • MGC14393
  • protein GPR108

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83629
Species: Hu
Applications: IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P

Publications for GPR108 Antibody (NBP2-56970) (0)

There are no publications for GPR108 Antibody (NBP2-56970).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR108 Antibody (NBP2-56970) (0)

There are no reviews for GPR108 Antibody (NBP2-56970). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GPR108 Antibody (NBP2-56970). (Showing 1 - of FAQ).

    Secondary Antibodies

     

    Isotype Controls

    Other Available Formats

    Additional GPR108 Products

    Bioinformatics Tool for GPR108 Antibody (NBP2-56970)

    Discover related pathways, diseases and genes to GPR108 Antibody (NBP2-56970). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
    Visit Tool

    Blogs on GPR108

    There are no specific blogs for GPR108, but you can read our latest blog posts.
    Coronavirus Brochure

    Customers Who Bought This Also Bought

    Contact Information

    Learn the difference between western blot and simple western

    Product PDFs

    Calculators

    Concentration Calculator

    The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

    =
    ÷

    Review this Product

    Be the first to review our GPR108 Antibody and receive a gift card or discount.

    Bioinformatics

    Gene Symbol GPR108