GLI4 Antibody

Images

 
Western Blot: GLI4 Antibody [NBP2-84972] - WB Suggested Anti-GLI4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: Human Stomach

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLI4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GLI4. Peptide sequence: TFWPDSEPKPEQAPRSPGSQAPDEGAGGALRSLLRSLPRRARCSAGFGPE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
GLI4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GLI4 Antibody

  • GLI family zinc finger 4
  • GLI-Kruppel family member GLI4
  • glioma-associated oncogene family zinc finger 4
  • HKR4GLI-Kruppel family member GLI4 (oncogene HKR4)
  • Krueppel-related zinc finger protein 4
  • Protein HKR4
  • zinc finger protein GLI4
  • ZNF928

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP3-06253
Species: Hu
Applications: IHC, IHC-P, IP, WB
AF3690
Species: Hu, Mu
Applications: ChIP, ICC, WB
NBP2-84972
Species: Hu
Applications: WB

Publications for GLI4 Antibody (NBP2-84972) (0)

There are no publications for GLI4 Antibody (NBP2-84972).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLI4 Antibody (NBP2-84972) (0)

There are no reviews for GLI4 Antibody (NBP2-84972). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLI4 Antibody (NBP2-84972) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLI4 Products

Bioinformatics Tool for GLI4 Antibody (NBP2-84972)

Discover related pathways, diseases and genes to GLI4 Antibody (NBP2-84972). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLI4 Antibody (NBP2-84972)

Discover more about diseases related to GLI4 Antibody (NBP2-84972).

Blogs on GLI4

There are no specific blogs for GLI4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLI4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLI4