Western Blot: FUNDC1 Antibody [NBP1-81063] - Analysis in control (vector only transfected HEK293T lysate) and FUNDC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: FUNDC1 Antibody [NBP1-81063] - Staining of human prostate shows moderate to strong cytoplasmic positivity in smooth muscle cells.
Western Blot: FUNDC1 Antibody [NBP1-81063] - Analysis in human cell line HEK 293.
Immunohistochemistry-Paraffin: FUNDC1 Antibody [NBP1-81063] - Staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FUNDC1 Antibody [NBP1-81063] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: FUNDC1 Antibody [NBP1-81063] - Staining of human liver shows no positivity in hepatocytes as expected.
Novus Biologicals Rabbit FUNDC1 Antibody - BSA Free (NBP1-81063) is a polyclonal antibody validated for use in IHC, WB and IP. Anti-FUNDC1 Antibody: Cited in 6 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVM
Predicted Species
Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FUNDC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Use in Mouse reported in scientific literature (PMID:30646747).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for FUNDC1 Antibody - BSA Free
FUN14 domain containing 1
FUN14 domain-containing protein 1
MGC51029
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our FUNDC1 Antibody - BSA Free and receive a gift card or discount.