FUNDC1 Antibody

Images

 
Western Blot: FUNDC1 Antibody [NBP1-81063] - Analysis in control (vector only transfected HEK293T lysate) and FUNDC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: FUNDC1 Antibody [NBP1-81063] - Staining of human prostate shows moderate to strong cytoplasmic positivity in smooth muscle cells.
Western Blot: FUNDC1 Antibody [NBP1-81063] - Analysis in human cell line HEK 293.
Immunohistochemistry-Paraffin: FUNDC1 Antibody [NBP1-81063] - Staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FUNDC1 Antibody [NBP1-81063] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: FUNDC1 Antibody [NBP1-81063] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FUNDC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVM
Predicted Species
Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FUNDC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Immunoprecipitation
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Use in Immunoprecipitation reported in scientific literature (PMID:29945885). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FUNDC1 Protein (NBP1-81063PEP)
Publications
Read Publications using
NBP1-81063 in the following applications:

  • IP
    1 publication
  • WB
    2 publications

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:30646747).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FUNDC1 Antibody

  • FUN14 domain containing 1
  • FUN14 domain-containing protein 1
  • MGC51029

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, Simple Western, SB, WB
NBP1-81063
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP

Publications for FUNDC1 Antibody (NBP1-81063)(4)

Reviews for FUNDC1 Antibody (NBP1-81063) (0)

There are no reviews for FUNDC1 Antibody (NBP1-81063). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FUNDC1 Antibody (NBP1-81063) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FUNDC1 Products

Bioinformatics Tool for FUNDC1 Antibody (NBP1-81063)

Discover related pathways, diseases and genes to FUNDC1 Antibody (NBP1-81063). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FUNDC1 Antibody (NBP1-81063)

Discover more about diseases related to FUNDC1 Antibody (NBP1-81063).

PTMs for FUNDC1 Antibody (NBP1-81063)

Learn more about PTMs related to FUNDC1 Antibody (NBP1-81063).
 

Research Areas for FUNDC1 Antibody (NBP1-81063)

Find related products by research area.

Blogs on FUNDC1

There are no specific blogs for FUNDC1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FUNDC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FUNDC1
Entrez
Uniprot