FUNDC1 Antibody - BSA Free

Images

 
Western Blot: FUNDC1 Antibody [NBP1-81063] - Analysis in control (vector only transfected HEK293T lysate) and FUNDC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: FUNDC1 Antibody [NBP1-81063] - Staining of human prostate shows moderate to strong cytoplasmic positivity in smooth muscle cells.
Western Blot: FUNDC1 Antibody [NBP1-81063] - Analysis in human cell line HEK 293.
Immunohistochemistry-Paraffin: FUNDC1 Antibody [NBP1-81063] - Staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FUNDC1 Antibody [NBP1-81063] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: FUNDC1 Antibody [NBP1-81063] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

FUNDC1 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVM
Predicted Species
Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FUNDC1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation Reported in scientific literature (PMID:29945885)
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FUNDC1 Protein (NBP1-81063PEP)
Publications
Read Publications using
NBP1-81063 in the following applications:

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:30646747).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FUNDC1 Antibody - BSA Free

  • FUN14 domain containing 1
  • FUN14 domain-containing protein 1
  • MGC51029

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, IP, Simple Western, SB, WB
NBP1-81063
Species: Hu, Mu, Rt
Applications: WB, IHC, IP

Publications for FUNDC1 Antibody (NBP1-81063)(6)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: IP, WB, Western Blot.


Filter By Application
IP
(1)
WB
(2)
Western Blot
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(2)
All Species
Showing Publications 1 - 6 of 6.
Publications using NBP1-81063 Applications Species
Kaur, B;Miglioranza Scavuzzi, B;Yang, M;Yao, J;Jia, L;Abcouwer, SF;Zacks, DN; ER Stress and Mitochondrial Perturbations Regulate Cell Death in Retinal Detachment: Exploring the Role of HIF1? Investigative ophthalmology & visual science 2024-09-03 [PMID: 39325470]
Jage?i? D, Petrovi? DJ, Šimuni? I et al. The Oxygen and Glucose Deprivation of Immature Cells of the Nervous System Exerts Distinct Effects on Mitochondria, Mitophagy, and Autophagy, Depending on the Cells' Differentiation Stage Brain sciences 2023-06-04 [PMID: 37371388] (Western Blot) Western Blot
Wang C, Dai X, Wu S et al. FUNDC1-dependent mitochondria-associated endoplasmic reticulum membranes are involved in angiogenesis and neoangiogenesis Nature communications 2021-05-10 [PMID: 33972548]
Livingston MJ, Wang J, Zhou J et al. Clearance of damaged mitochondria via mitophagy is important to the protective effect of ischemic preconditioning in kidneys Autophagy 2019-05-22 [PMID: 31066324] (WB, Human) WB Human
Wu S, Lu Q et al. Hyperglycemia-Driven Inhibition of AMP-Activated Protein Kinase alpha 2 Induces Diabetic Cardiomyopathy by Promoting Mitochondria-Associated Endoplasmic Reticulum Membranes In Vivo. Circulation 2019-04-16 [PMID: 30646747] (WB, Mouse) WB Mouse
Singh B K, Sinha R A et al. Thyroid hormone receptor and ERR alpha coordinately regulate mitochondrial fission, mitophagy, biogenesis, and function. Sci Signal 2018-06-26 [PMID: 29945885] (IP, Mouse) IP Mouse

Reviews for FUNDC1 Antibody (NBP1-81063) (0)

There are no reviews for FUNDC1 Antibody (NBP1-81063). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FUNDC1 Antibody (NBP1-81063) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FUNDC1 Products

Research Areas for FUNDC1 Antibody (NBP1-81063)

Find related products by research area.

Blogs on FUNDC1

There are no specific blogs for FUNDC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FUNDC1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol FUNDC1
Entrez
Uniprot