FSCN3 Antibody

Western Blot: FSCN3 Antibody [NBP1-79541] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

FSCN3 Antibody Summary

• Immunogen: Synthetic peptide directed towards the C terminal of human FSCN3The immunogen for this antibody is FSCN3. Peptide sequence YDGEVRAASERLNRMSLFQFECDSESPTVQLRSANGYYLSQRRHRAVMAD. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FSCN3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against FSCN3 and was validated on Western blot.
• Theoretical MW: 55 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FSCN3 Antibody

• fascin (Strongylocentrotus purpuratus) homolog 3 (actin-bundling protein
• fascin homolog 3, actin-bundling protein, testicular (Strongylocentrotuspurpuratus)
• fascin-3
• testicular)
• Testis fascin

Background

FSCN3 acts as an actin bundling protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FSCN3
• Uniprot:
  • NP_065102(Human)