![Western Blot: FOLR4 Antibody [NBP1-91496] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/FOLR4 Antibody-Western Blot-NBP1-91496-img0002.jpg "Western Blot: FOLR4 Antibody [NBP1-91496] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.")
| Reactivity | Hu, Eq, GPSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human FOLR4. Peptide sequence TCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKAS. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IZUMO1R |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This is a rabbit polyclonal antibody against FOLR4 and was validated on Western blot. |
| Theoretical MW | 28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for FOLR4 Antibody (NBP1-91496)Discover more about diseases related to FOLR4 Antibody (NBP1-91496).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IZUMO1R |
![Western Blot: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Analysis using Anti-BLVRB antibody NBP1-83435 (A) shows similar pattern to independent antibody NBP1-83434 (B).](http://images.novusbio.com/fullsize2/Biliverdin-Reductase-B-BLVRB-Antibody-Western-Blot-NBP1-83435-img0014.jpg)
![Immunocytochemistry/Immunofluorescence: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/Biliverdin-Reductase-B-BLVRB-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83435-img0007.jpg)
![Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize2/Biliverdin-Reductase-B-BLVRB-Antibody-Immunohistochemistry-Paraffin-NBP1-83435-img0020.jpg)
![Western Blot: Band 3 Antibody (BIII 136) [NB120-11012] - Human erythrocytes ghosts extract was separated on SDS-PAGE and probed with Monoclonal Anti-Band 3 Clone: BIII-136. The antibody was developed using Goat Anti-Mouse IgG-Peroxidase and AEC substrate.](http://images.novusbio.com/fullsize2/Band-3-Antibody-(BIII-136)-Western-Blot-NB120-11012-img0001.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")