Recombinant Human FKTN GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human FKTN Protein [H00002218-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human FKTN GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 29-138 of Human FKTN

Source: Wheat Germ (in vitro)

Amino Acid Sequence: KHYLSTKNGAGLSKSKGSRIGFDSTQWRAVKKFIMLTSNQNVPVFLIDPLILELINKNFEQVKNTSHGSTSQCKFFCVPRDFTAFALQYHLWKNEEGWFRIAENMGFQCL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FKTN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FKTN GST (N-Term) Protein

  • CMD1X
  • EC 2.-
  • FCMDMGC134945
  • fukutin
  • Fukuyama type congenital muscular dystrophy (fukutin)
  • Fukuyama type congenital muscular dystrophy protein
  • Fukuyama-type congenital muscular dystrophy protein
  • LGMD2MMGC134944
  • MDDGA4
  • MDDGB4
  • MDDGC4
  • MGC126857
  • MGC138243

Background

FCMD - Fukuyama type congenital muscular dystrophy (fukutin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7414-GT
Species: Hu
Applications: EnzAct
NBP3-04945
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF6868
Species: Hu
Applications: IHC, KO, WB
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP3-12334
Species: Hu, Mu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
NBP2-62211
Species: Hu
Applications: Flow-IC, Flow, WB
NBP1-85630
Species: Hu
Applications: IHC, IHC-P, WB
8184-CK
Species: Hu
Applications: EnzAct
NBP2-46624
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
550-AG/CF
Species: Rt
Applications: BA, BA
NBP2-66814
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for FKTN Partial Recombinant Protein (H00002218-Q01) (0)

There are no publications for FKTN Partial Recombinant Protein (H00002218-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKTN Partial Recombinant Protein (H00002218-Q01) (0)

There are no reviews for FKTN Partial Recombinant Protein (H00002218-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FKTN Partial Recombinant Protein (H00002218-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FKTN Products

Bioinformatics Tool for FKTN Partial Recombinant Protein (H00002218-Q01)

Discover related pathways, diseases and genes to FKTN Partial Recombinant Protein (H00002218-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKTN Partial Recombinant Protein (H00002218-Q01)

Discover more about diseases related to FKTN Partial Recombinant Protein (H00002218-Q01).
 

Pathways for FKTN Partial Recombinant Protein (H00002218-Q01)

View related products by pathway.

PTMs for FKTN Partial Recombinant Protein (H00002218-Q01)

Learn more about PTMs related to FKTN Partial Recombinant Protein (H00002218-Q01).
 

Research Areas for FKTN Partial Recombinant Protein (H00002218-Q01)

Find related products by research area.

Blogs on FKTN

There are no specific blogs for FKTN, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FKTN GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FKTN