FAM73A Antibody

Images

 
Western Blot: FAM73A Antibody [NBP2-84924] - Host: Rabbit. Target Name: FAM73A. Sample Type: OVCAR-3 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Rt, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM73A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM73A. Peptide sequence: SRQNLTLSLSSTKDKGSQVCNYANGGLFSKYSGSAQSLASVQSVNSCHSC The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (93%), Rabbit (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
FAM73A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM73A Antibody

  • DKFZp686M07166
  • family with sequence similarity 73, member A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83116
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31603
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58704
Species: Hu
Applications: ICC/IF
NBP2-01171
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB6715
Species: Hu
Applications: WB
NBP2-30814
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-84924
Species: Hu, Rt, Rb
Applications: WB

Publications for FAM73A Antibody (NBP2-84924) (0)

There are no publications for FAM73A Antibody (NBP2-84924).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM73A Antibody (NBP2-84924) (0)

There are no reviews for FAM73A Antibody (NBP2-84924). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM73A Antibody (NBP2-84924) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM73A Products

Bioinformatics Tool for FAM73A Antibody (NBP2-84924)

Discover related pathways, diseases and genes to FAM73A Antibody (NBP2-84924). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM73A Antibody (NBP2-84924)

Discover more about diseases related to FAM73A Antibody (NBP2-84924).

Blogs on FAM73A

There are no specific blogs for FAM73A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM73A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM73A